Helicobacter pylori BM012S: U064_0870 Help Entry U064_0870         CDS       T02940                                  Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism hez  Helicobacter pylori BM012S Pathway hez01100   Metabolic pathways hez01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hez00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     U064_0870    00074 Mycolic acid biosynthesis     U064_0870   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     U064_0870 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L12_N DUF7080 PP-binding_2 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  AHA89785 UniProt:  V5NMG2 LinkDB All DBs Position complement(869176..869412) Genome browser AA seq 78 aa AA seqDB search MALFEDIQAVIAEQLNVDAAQVTPEAEFVKDLGADSLDVVELIMALEEKFGVEIPDEQAE KIVNVGDVVKYIEDNKLA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atggctttatttgaagatattcaggcagttattgctgagcaattgaatgtggatgcggcg caagttacgccagaggcggaatttgtgaaggacttgggtgcggactctttagatgtcgtg gaattaatcatggcgttagaagaaaagtttggcgttgagattcctgatgagcaagcggaa aaaatcgtcaatgtgggcgatgtggtgaagtatattgaggacaataaactggcttaa

DBGET integrated database retrieval system