Hyphococcus flavus: PUV54_05050 Help Entry PUV54_05050       CDS       T08821                                  Symbol groES Name (GenBank) co-chaperone GroES   KO K04078   chaperonin GroES Organism hfl  Hyphococcus flavus Brite KEGG Orthology (KO) [BR:hfl00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:hfl03110]     PUV54_05050 (groES)    03029 Mitochondrial biogenesis [BR:hfl03029]     PUV54_05050 (groES) Chaperones and folding catalysts [BR:hfl03110]  Heat shock proteins   HSP10    PUV54_05050 (groES) Mitochondrial biogenesis [BR:hfl03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     PUV54_05050 (groES) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cpn10 Motif Other DBs NCBI-ProteinID:  WDI32561 UniProt:  A0AAF0CFK9 LinkDB All DBs Position 1043730..1044017 Genome browser AA seq 95 aa AA seqDB search MAFRPLHDRVLVRRIEEDEKTAGGIIIPDTAKEKPQQGEVVACGSGARGDDNEIVPLDVK SGDKILFGKWSGSEVKIDGEDLLIMKESDILGIID NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atggctttcaggcctctccatgaccgcgtgttggtccgtcgtatcgaagaagacgaaaaa accgctggcggcatcatcatccccgataccgcgaaggaaaagccccagcagggcgaagtt gtagcgtgcggctcaggcgcgcgcggcgacgacaatgaaatcgtgccgctagacgtcaag tctggcgacaaaatcctgttcggcaagtggtcgggctcggaagtgaaaatcgacggtgag gatctcttgatcatgaaagagtccgacatcctcgggatcatcgactaa

DBGET integrated database retrieval system