Hyphococcus formosus: ABFZ83_02585 Help Entry ABFZ83_02585      CDS       T10776                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism hfo  Hyphococcus formosus Pathway hfo01100   Metabolic pathways hfo01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hfo00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ABFZ83_02585    00074 Mycolic acid biosynthesis     ABFZ83_02585   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ABFZ83_02585 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1493 Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  XMO97424 LinkDB All DBs Position 561457..561693 Genome browser AA seq 78 aa AA seqDB search MSDLAERVKKIVVEHLDVDAAKVEPKASFIDDLGADSLDIVELVMAFEEEFDVEIPDDAA ETIQSVGDAIKFIEEQKK NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgtctgatctcgcggaacgcgtaaagaaaattgttgtcgagcacctcgacgtggatgca gctaaagttgagccgaaagcgagctttatcgatgacctcggtgccgatagtcttgatatc gtcgagctggttatggcgttcgaagaagaatttgacgttgaaattcctgatgacgctgct gaaacgatccaatcggttggcgacgctatcaagtttatcgaagagcaaaagaagtaa

DBGET integrated database retrieval system