Herbaspirillum frisingense: G5S34_10620 Help Entry G5S34_10620       CDS       T06761                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism hfr  Herbaspirillum frisingense Pathway hfr01100   Metabolic pathways hfr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hfr00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     G5S34_10620 (acpP)    00074 Mycolic acid biosynthesis     G5S34_10620 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     G5S34_10620 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 Ribosomal_L50 MAP DUF1493 Motif Other DBs NCBI-ProteinID:  QNB07183 LinkDB All DBs Position 2353907..2354146 Genome browser AA seq 79 aa AA seqDB search MSDIEQRVKKIVAEQLGVAEADIKNESSFVDDLGADSLDTVELVMALEDEFEMEIPDEQA EKITTVQQAIDYAKSQVKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgtccgatatcgaacaacgcgtgaagaagatcgtcgctgagcaactgggcgtcgccgaa gccgacatcaagaacgaatcgtcgttcgtggacgacctgggcgccgactcgctggacacc gtggagctggtcatggcactggaagatgagttcgaaatggaaatccccgacgaacaagcc gaaaagatcaccaccgtgcaacaggcgatcgactacgccaagtcgcaagtcaaggcctga

DBGET integrated database retrieval system