Candidatus Hydrogenisulfobacillus filiaventi: R50_1268
Help
Entry
R50_1268 CDS
T08923
Symbol
truB
Name
(GenBank) tRNA pseudouridine synthase B
KO
K03177
tRNA pseudouridine55 synthase [EC:
5.4.99.25
]
Organism
hfv
Candidatus Hydrogenisulfobacillus filiaventi
Brite
KEGG Orthology (KO) [BR:
hfv00001
]
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03016 Transfer RNA biogenesis [BR:
hfv03016
]
R50_1268 (truB)
Enzymes [BR:
hfv01000
]
5. Isomerases
5.4 Intramolecular transferases
5.4.99 Transferring other groups
5.4.99.25 tRNA pseudouridine55 synthase
R50_1268 (truB)
Transfer RNA biogenesis [BR:
hfv03016
]
Eukaryotic type
tRNA modification factors
Psudouridine synthases
R50_1268 (truB)
Prokaryotic type
R50_1268 (truB)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
TruB_N
TruB_C_2
Motif
Other DBs
NCBI-ProteinID:
CAB1128774
UniProt:
A0A6F8ZFR4
LinkDB
All DBs
Position
1:1185323..1186213
Genome browser
AA seq
296 aa
AA seq
DB search
MTAGPEGILVVRKPAGLTSFAAVREVQRLTGAARAGHAGTLDPAAEGVLPVALGAATRWL
PWLKAEPKRYRAEVEFGRATASGDGDGPVVARSGRPWPGPEAVAAALRWLEGPQWQLPPS
FSAKKVGGVRAYARARRGRGVFPAPCRVDVQALAARGGGAHWTLEATVSGGTYIRSLVRD
LGELLGQAAVLTRLQRTAVGPFRLEQALTLEAVAAGAWREALLGPEAALDLPLIPVETAV
VPYLVQGRALAGLPLPPLPAAPAVGLAAGGRLVAIVEGPPGLRYRAVFPPVPAGSP
NT seq
891 nt
NT seq
+upstream
nt +downstream
nt
atgacggcgggcccggaaggcatcctggtggtccgcaagccggcgggcctgacctccttc
gccgccgtgcgggaggtgcaacgtctgaccggggccgcccgggcgggtcatgccgggacc
ctggacccggccgcggaaggggtgctgccggtggccctgggcgcggccacccgctggctg
ccgtggctgaaggcggagcctaagcgctaccgcgccgaggttgagttcgggcgcgccacc
gccagcggcgacggggatggtccggtggtggcccgttccggtcggccctggccggggccg
gaggcggtggcggcggccctgcgctggctggaggggccccaatggcagctgccgcccagc
ttttcggccaagaaggtgggcggcgtgcgggcctatgcccgggcccgccgcggacggggg
gtctttccggcgccctgccgggtggacgtccaggcgctggccgcccggggaggcggggcg
cattggaccctcgaagccacggtttcaggcggcacctacatccgcagcctggtgcgcgac
ctgggcgagctgctggggcaggcagcggtgctgacccgtctgcaacggactgcggtgggc
cccttccgcctcgagcaggccctgaccctggaggcggtggccgccggcgcctggcgcgag
gccctgctggggccggaagcggcgttggacctgccgctgattccggtggagacggcggtg
gtgccgtatctggtccagggccgggccctggccgggctgccgctgccgccgctgcccgcc
gccccggcggtgggactggcggccggcggtcggctggtagcgatcgtggaggggccgccc
ggcctccggtaccgggcggtgtttcccccggttccggcggggtccccctag
DBGET
integrated database retrieval system