Helicobacter gastrofelis: NHP190012_07560 Help Entry NHP190012_07560   CDS       T10844                                  Name (GenBank) hypothetical protein   KO K03116   sec-independent protein translocase protein TatA Organism hga  Helicobacter gastrofelis Pathway hga03060   Protein export hga03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:hga00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     NHP190012_07560  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     NHP190012_07560  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:hga02044]     NHP190012_07560 Secretion system [BR:hga02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    NHP190012_07560 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E Ni_hydr_CYTB Motif Other DBs NCBI-ProteinID:  BCZ19114 LinkDB All DBs Position complement(732637..732873) Genome browser AA seq 78 aa AA seqDB search MGTFSVWHWLIVLAVILLLFGAKKIPELAKGLGSGIKNFKKAIKEDEEEGKKPESVGMQP PQQSAQPTPTAPKQEQQS NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgggtacttttagtgtttggcattggttgattgttttagcggtgattttgcttttattt ggggcaaagaaaatccccgagttagccaaagggctaggcagcgggattaaaaacttcaaa aaggcgattaaggaggacgaggaggagggcaaaaaacccgagagtgtgggcatgcaaccc ccgcaacagagcgcgcaacccacccccaccgcccccaagcaagaacaacaaagctaa

DBGET integrated database retrieval system