Helicobacter gastrofelis: NHP190012_12770 Help Entry NHP190012_12770   CDS       T10844                                  Symbol acpP Name (GenBank) Acyl carrier protein AcpP   KO K02078   acyl carrier protein Organism hga  Helicobacter gastrofelis Pathway hga01100   Metabolic pathways hga01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hga00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     NHP190012_12770 (acpP)    00074 Mycolic acid biosynthesis     NHP190012_12770 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     NHP190012_12770 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 EFP Ribosomal_L12_N Ribosomal_L50 DUF7080 Guanylate_cyc Motif Other DBs NCBI-ProteinID:  BCZ19635 LinkDB All DBs Position complement(1210928..1211164) Genome browser AA seq 78 aa AA seqDB search MALFEDVQAVIVEQLNVNASQVTEEADFIKDLNADSLDVVELIMALEEKFGIEIPDEQAE KIKTVGDAIRFIQDNKLA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atggctttatttgaagatgtgcaggcagtgatcgtagagcagttaaatgtgaatgcatcg caggttacagaagaggcggactttatcaaggatttaaacgcggactcgctcgatgtggtg gagctcatcatggcccttgaagaaaaatttgggatcgaaatccccgatgagcaagctgaa aagatcaaaactgtgggtgatgcgatccgcttcattcaagacaacaaactcgcttaa

DBGET integrated database retrieval system