Heterocephalus glaber (naked mole-rat): 101697163 Help Entry 101697163         CDS       T02812                                  Name (RefSeq) interferon alpha-4-like   KO K05414   interferon alpha Organism hgl  Heterocephalus glaber (naked mole-rat) Pathway hgl04060   Cytokine-cytokine receptor interaction hgl04151   PI3K-Akt signaling pathway hgl04217   Necroptosis hgl04620   Toll-like receptor signaling pathway hgl04621   NOD-like receptor signaling pathway hgl04622   RIG-I-like receptor signaling pathway hgl04623   Cytosolic DNA-sensing pathway hgl04630   JAK-STAT signaling pathway hgl04650   Natural killer cell mediated cytotoxicity hgl04936   Alcoholic liver disease hgl05152   Tuberculosis hgl05160   Hepatitis C hgl05161   Hepatitis B hgl05162   Measles hgl05163   Human cytomegalovirus infection hgl05164   Influenza A hgl05165   Human papillomavirus infection hgl05167   Kaposi sarcoma-associated herpesvirus infection hgl05168   Herpes simplex virus 1 infection hgl05169   Epstein-Barr virus infection hgl05170   Human immunodeficiency virus 1 infection hgl05171   Coronavirus disease hgl05200   Pathways in cancer hgl05320   Autoimmune thyroid disease hgl05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:hgl00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     101697163    04151 PI3K-Akt signaling pathway     101697163   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     101697163  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     101697163  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     101697163    04621 NOD-like receptor signaling pathway     101697163    04622 RIG-I-like receptor signaling pathway     101697163    04623 Cytosolic DNA-sensing pathway     101697163    04650 Natural killer cell mediated cytotoxicity     101697163  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     101697163   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     101697163    05161 Hepatitis B     101697163    05160 Hepatitis C     101697163    05171 Coronavirus disease     101697163    05164 Influenza A     101697163    05162 Measles     101697163    05168 Herpes simplex virus 1 infection     101697163    05163 Human cytomegalovirus infection     101697163    05167 Kaposi sarcoma-associated herpesvirus infection     101697163    05169 Epstein-Barr virus infection     101697163    05165 Human papillomavirus infection     101697163   09171 Infectious disease: bacterial    05152 Tuberculosis     101697163   09163 Immune disease    05320 Autoimmune thyroid disease     101697163   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     101697163   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     101697163  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:hgl04052]     101697163 Cytokines and neuropeptides [BR:hgl04052]  Cytokines   Interferons    101697163 SSDB OrthologParalogGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  101697163 NCBI-ProteinID:  XP_004875569 UniProt:  A0AAX6QKW3 LinkDB All DBs Position Un AA seq 187 aa AA seqDB search MAWPLSVLVALVVLTIMSSCSLGCDLPRTHSQGNRRALTLLEQMRRISTFSCLKDREDFG LPHQEFDGKQIQKAQAISVLHEMTSQTFNLFSTQDSSAAWNNGLLDTFCTGLHQQLSDLE ACLTQEVGQEEAPISHEDSRLAVRKYFHRITLYLKEKRYSPCAWEVVRAEIMRSFSSSEK LARKVKD NT seq 564 nt NT seq  +upstreamnt  +downstreamnt atggcctggccactttctgtactggtggccctggtggtgctcaccatcatgtcatcgtgc tctctgggctgtgacctgcctcgaacccacagccaggggaacaggagggccttgacacta ctggaacaaatgaggagaatctccactttctcctgcctgaaggacagagaggactttggc ctcccccaccaggagtttgatggcaaacagatccagaaggctcaggccatctctgtcctc catgagatgaccagccagaccttcaacctcttcagcacacaggattcatctgccgcctgg aacaatggcctgctggacaccttctgcaccggcctccatcagcagctgagtgatctggag gcctgcctgacccaggaggtggggcaggaagaggcgcccatctcgcatgaggactccaga ctggctgtgaggaaatacttccacaggatcactctctacctgaaggagaagcgatacagc ccttgtgcctgggaagttgtcagagcagaaatcatgagatccttctcttcatcggagaaa cttgcaagaaaggtgaaagactaa

DBGET integrated database retrieval system