Heterocephalus glaber (naked mole-rat): 101697698 Help Entry 101697698         CDS       T02812                                  Symbol Ccl17 Name (RefSeq) C-C motif chemokine ligand 17   KO K21083   C-C motif chemokine 17 Organism hgl  Heterocephalus glaber (naked mole-rat) Pathway hgl04060   Cytokine-cytokine receptor interaction hgl04061   Viral protein interaction with cytokine and cytokine receptor hgl04062   Chemokine signaling pathway hgl04625   C-type lectin receptor signaling pathway hgl04657   IL-17 signaling pathway Brite KEGG Orthology (KO) [BR:hgl00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     101697698 (Ccl17)    04061 Viral protein interaction with cytokine and cytokine receptor     101697698 (Ccl17)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     101697698 (Ccl17)    04657 IL-17 signaling pathway     101697698 (Ccl17)    04062 Chemokine signaling pathway     101697698 (Ccl17)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:hgl04052]     101697698 (Ccl17) Cytokines and neuropeptides [BR:hgl04052]  Cytokines   Chemokines    101697698 (Ccl17) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  101697698 NCBI-ProteinID:  XP_004843225 UniProt:  G5AUE4 LinkDB All DBs Position Un AA seq 101 aa AA seqDB search MRSLKTLFLAALLLGASLQFSRAARATNVGRECCLEYFKGAIPSKKLVHWYRTSSECPRD AIVFVTVRARLICSDPENWLVKKAVRYLDSLKKSHRTTTQD NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atgaggtccctgaagacgctgttcctggccgccctgctgctgggcgcctctctgcagttc agccgagcagctcgagccaccaacgtggggcgggagtgctgcctggagtacttcaaggga gccattcccagcaaaaagctggtgcactggtacaggacctcgtccgagtgtcccagggac gccattgtgtttgtgactgtcagggccaggctcatctgctcggaccctgagaactggctc gtgaagaaggcagttagatacttggacagcctcaagaagtcacacaggaccaccacccag gactga

DBGET integrated database retrieval system