Heterocephalus glaber (naked mole-rat): 101697988 Help Entry 101697988         CDS       T02812                                  Symbol Ccl2 Name (RefSeq) C-C motif chemokine 2   KO K14624   C-C motif chemokine 2 Organism hgl  Heterocephalus glaber (naked mole-rat) Pathway hgl04060   Cytokine-cytokine receptor interaction hgl04061   Viral protein interaction with cytokine and cytokine receptor hgl04062   Chemokine signaling pathway hgl04621   NOD-like receptor signaling pathway hgl04657   IL-17 signaling pathway hgl04668   TNF signaling pathway hgl04933   AGE-RAGE signaling pathway in diabetic complications hgl05135   Yersinia infection hgl05142   Chagas disease hgl05144   Malaria hgl05163   Human cytomegalovirus infection hgl05164   Influenza A hgl05168   Herpes simplex virus 1 infection hgl05171   Coronavirus disease - COVID-19 hgl05323   Rheumatoid arthritis hgl05417   Lipid and atherosclerosis hgl05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:hgl00001]  09130 Environmental Information Processing   09132 Signal transduction    04668 TNF signaling pathway     101697988 (Ccl2)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     101697988 (Ccl2)    04061 Viral protein interaction with cytokine and cytokine receptor     101697988 (Ccl2)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     101697988 (Ccl2)    04657 IL-17 signaling pathway     101697988 (Ccl2)    04062 Chemokine signaling pathway     101697988 (Ccl2)  09160 Human Diseases   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     101697988 (Ccl2)    05164 Influenza A     101697988 (Ccl2)    05168 Herpes simplex virus 1 infection     101697988 (Ccl2)    05163 Human cytomegalovirus infection     101697988 (Ccl2)   09171 Infectious disease: bacterial    05135 Yersinia infection     101697988 (Ccl2)   09174 Infectious disease: parasitic    05144 Malaria     101697988 (Ccl2)    05142 Chagas disease     101697988 (Ccl2)   09163 Immune disease    05323 Rheumatoid arthritis     101697988 (Ccl2)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     101697988 (Ccl2)    05418 Fluid shear stress and atherosclerosis     101697988 (Ccl2)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     101697988 (Ccl2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:hgl04052]     101697988 (Ccl2)    00536 Glycosaminoglycan binding proteins [BR:hgl00536]     101697988 (Ccl2) Cytokines and neuropeptides [BR:hgl04052]  Cytokines   Chemokines    101697988 (Ccl2) Glycosaminoglycan binding proteins [BR:hgl00536]  Heparan sulfate / Heparin   Chemokines    101697988 (Ccl2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  101697988 NCBI-ProteinID:  XP_004870672 UniProt:  G5B765 LinkDB All DBs Position Un AA seq 119 aa AA seqDB search MQVSAVILCLMLTAATFSTPLLAQPDGVNAPVCCYIFNKKIPLKRVVSYERITSSRCPKE AVIFQTIANREICADPTQKWVKDYIAKLDQKTQLKQNSTAPATSILLNTSFTTQEPKNL NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atgcaggtctctgcagtcattctgtgcctgatgctcacagcagccaccttcagcaccccc ctgctggctcagccagatggagttaatgccccagtctgctgctatatatttaacaaaaag atcccactgaagagggtggtgagctatgaaagaatcaccagcagcaggtgtcccaaagaa gctgtgatcttccagaccatagcgaacagggagatctgcgctgaccccacgcagaagtgg gtcaaggactacattgccaaactggaccagaaaacccagctgaaacagaattcaactgca ccagcaacttcaatcctcttgaacactagcttcaccacccaagagcctaaaaacctgtag

DBGET integrated database retrieval system