Heterocephalus glaber (naked mole-rat): 101698645 Help Entry 101698645         CDS       T02812                                  Symbol Gnai2 Name (RefSeq) G protein subunit alpha i2   KO K04630   guanine nucleotide-binding protein G(i) subunit alpha Organism hgl  Heterocephalus glaber (naked mole-rat) Pathway hgl04015   Rap1 signaling pathway hgl04022   cGMP-PKG signaling pathway hgl04024   cAMP signaling pathway hgl04062   Chemokine signaling pathway hgl04071   Sphingolipid signaling pathway hgl04081   Hormone signaling hgl04082   Neuroactive ligand signaling hgl04261   Adrenergic signaling in cardiomyocytes hgl04360   Axon guidance hgl04371   Apelin signaling pathway hgl04540   Gap junction hgl04611   Platelet activation hgl04670   Leukocyte transendothelial migration hgl04713   Circadian entrainment hgl04723   Retrograde endocannabinoid signaling hgl04724   Glutamatergic synapse hgl04725   Cholinergic synapse hgl04726   Serotonergic synapse hgl04727   GABAergic synapse hgl04728   Dopaminergic synapse hgl04730   Long-term depression hgl04914   Progesterone-mediated oocyte maturation hgl04915   Estrogen signaling pathway hgl04916   Melanogenesis hgl04921   Oxytocin signaling pathway hgl04923   Regulation of lipolysis in adipocytes hgl04924   Renin secretion hgl04926   Relaxin signaling pathway hgl04928   Parathyroid hormone synthesis, secretion and action hgl04934   Cushing syndrome hgl04935   Growth hormone synthesis, secretion and action hgl04971   Gastric acid secretion hgl05012   Parkinson disease hgl05030   Cocaine addiction hgl05032   Morphine addiction hgl05034   Alcoholism hgl05133   Pertussis hgl05142   Chagas disease hgl05145   Toxoplasmosis hgl05163   Human cytomegalovirus infection hgl05170   Human immunodeficiency virus 1 infection hgl05200   Pathways in cancer hgl05207   Chemical carcinogenesis - receptor activation Brite KEGG Orthology (KO) [BR:hgl00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     101698645 (Gnai2)    04371 Apelin signaling pathway     101698645 (Gnai2)    04071 Sphingolipid signaling pathway     101698645 (Gnai2)    04024 cAMP signaling pathway     101698645 (Gnai2)    04022 cGMP-PKG signaling pathway     101698645 (Gnai2)   09133 Signaling molecules and interaction    04082 Neuroactive ligand signaling     101698645 (Gnai2)    04081 Hormone signaling     101698645 (Gnai2)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04540 Gap junction     101698645 (Gnai2)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     101698645 (Gnai2)    04670 Leukocyte transendothelial migration     101698645 (Gnai2)    04062 Chemokine signaling pathway     101698645 (Gnai2)   09152 Endocrine system    04923 Regulation of lipolysis in adipocytes     101698645 (Gnai2)    04915 Estrogen signaling pathway     101698645 (Gnai2)    04914 Progesterone-mediated oocyte maturation     101698645 (Gnai2)    04921 Oxytocin signaling pathway     101698645 (Gnai2)    04926 Relaxin signaling pathway     101698645 (Gnai2)    04935 Growth hormone synthesis, secretion and action     101698645 (Gnai2)    04928 Parathyroid hormone synthesis, secretion and action     101698645 (Gnai2)    04916 Melanogenesis     101698645 (Gnai2)    04924 Renin secretion     101698645 (Gnai2)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     101698645 (Gnai2)   09154 Digestive system    04971 Gastric acid secretion     101698645 (Gnai2)   09156 Nervous system    04724 Glutamatergic synapse     101698645 (Gnai2)    04727 GABAergic synapse     101698645 (Gnai2)    04725 Cholinergic synapse     101698645 (Gnai2)    04728 Dopaminergic synapse     101698645 (Gnai2)    04726 Serotonergic synapse     101698645 (Gnai2)    04730 Long-term depression     101698645 (Gnai2)    04723 Retrograde endocannabinoid signaling     101698645 (Gnai2)   09158 Development and regeneration    04360 Axon guidance     101698645 (Gnai2)   09159 Environmental adaptation    04713 Circadian entrainment     101698645 (Gnai2)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     101698645 (Gnai2)    05207 Chemical carcinogenesis - receptor activation     101698645 (Gnai2)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     101698645 (Gnai2)    05163 Human cytomegalovirus infection     101698645 (Gnai2)   09171 Infectious disease: bacterial    05133 Pertussis     101698645 (Gnai2)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     101698645 (Gnai2)    05142 Chagas disease     101698645 (Gnai2)   09164 Neurodegenerative disease    05012 Parkinson disease     101698645 (Gnai2)   09165 Substance dependence    05030 Cocaine addiction     101698645 (Gnai2)    05032 Morphine addiction     101698645 (Gnai2)    05034 Alcoholism     101698645 (Gnai2)   09167 Endocrine and metabolic disease    04934 Cushing syndrome     101698645 (Gnai2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hgl04147]     101698645 (Gnai2)    04031 GTP-binding proteins [BR:hgl04031]     101698645 (Gnai2) Exosome [BR:hgl04147]  Exosomal proteins   Proteins found in most exosomes    101698645 (Gnai2) GTP-binding proteins [BR:hgl04031]  Heterotrimeric G-proteins   Alpha Subunits    Alpha type 1 (Gi/o) [OT]     101698645 (Gnai2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  G-alpha Arf Gtr1_RagA Roc TniB GTP_EFTU AAA_16 FtsK_SpoIIIE AAA_29 Motif Other DBs NCBI-GeneID:  101698645 NCBI-ProteinID:  XP_004834147 UniProt:  A0A0P6J8H1 LinkDB All DBs Position Un AA seq 355 aa AA seqDB search MGCTVSAEDKAAAERSKMIDKNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEDG YSEEECRQYRAVVYSNTIQSIMAIVKAMGNLQIDFADPHRADDARQLFALSCTAEEQGML PEDLSSVIRRLWADHGVQACFSRSREYQLNDSAAYYLNDLERIAQSDYIPTQQDVLRTRV KTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSAYDLVLAEDEE MNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKITHSPLTICFPEYTGASKYDEA ASYIQSKFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt atggggtgcactgtgagcgctgaggacaaggcggcggccgagcgctccaagatgatcgac aagaacctgcgggaggacggcgagaaggcggcgcgggaggtgaagttgcttctgttaggt gctggcgagtcagggaagagcaccatcgtcaaacagatgaagatcatccatgaagatggc tattcagaggaagagtgccggcagtaccgggcagtcgtttacagcaacaccatccagtcc atcatggccattgtcaaggccatgggcaacctgcagattgactttgccgacccccaccgc gcggacgatgccaggcagctgttcgcactgtcttgcactgctgaggagcaaggcatgctc cctgaggacctgtccagtgtcatccggaggctctgggctgaccatggtgtgcaggcctgc ttcagccgctcgagagaataccagctcaacgactcagctgcctactacctgaatgacctg gagcggattgctcagagtgactacatccccacacagcaggatgtgcttcggacacgcgtg aagaccacgggtattgtggaaacacactttaccttcaaggacctacacttcaagatgttt gatgtgggcggtcagcggtctgagcgaaagaagtggatccactgcttcgagggtgtcaca gccatcatcttctgtgtagccttgagcgcctatgacttggtgctagctgaggatgaggag atgaaccgcatgcatgagagcatgaagctgtttgacagcatctgtaacaacaaatggttc acggacacgtccatcatccttttcctcaacaagaaggacctgttcgaggagaagatcaca cacagcccactgaccatctgcttcccagagtacacaggagccagcaagtatgatgaggca gccagctacatccagagtaagtttgaggacctgaataaacgcaaagacaccaaggagatc tacacacacttcacatgcgctaccgacaccaagaacgtgcagtttgtgtttgacgctgtc actgacgtcatcatcaagaacaacctgaaggactgcggcctcttctaa

DBGET integrated database retrieval system