Heterocephalus glaber (naked mole-rat): 101698865 Help Entry 101698865         CDS       T02812                                  Symbol Ccl11 Name (RefSeq) eotaxin   KO K16597   C-C motif chemokine 11 Organism hgl  Heterocephalus glaber (naked mole-rat) Pathway hgl04060   Cytokine-cytokine receptor interaction hgl04061   Viral protein interaction with cytokine and cytokine receptor hgl04062   Chemokine signaling pathway hgl04657   IL-17 signaling pathway hgl05310   Asthma Brite KEGG Orthology (KO) [BR:hgl00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     101698865 (Ccl11)    04061 Viral protein interaction with cytokine and cytokine receptor     101698865 (Ccl11)  09150 Organismal Systems   09151 Immune system    04657 IL-17 signaling pathway     101698865 (Ccl11)    04062 Chemokine signaling pathway     101698865 (Ccl11)  09160 Human Diseases   09163 Immune disease    05310 Asthma     101698865 (Ccl11)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:hgl04052]     101698865 (Ccl11) Cytokines and neuropeptides [BR:hgl04052]  Cytokines   Chemokines    101698865 (Ccl11) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 ICAM_N SmAKAP CXCL16 Motif Other DBs NCBI-GeneID:  101698865 NCBI-ProteinID:  XP_004870675 UniProt:  G5B764 LinkDB All DBs Position Un AA seq 107 aa AA seqDB search MKVSTAFLCLLLTANTFSPQILAQPGTVPNTCCFAVTNKKILIQRLESYRIITSSKCPQT AVIFKTKLNKEICADPKQKWVQNSIKYLDQISQTTKPSSPFLKLTRA NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atgaaggtctccacagcgtttctgtgcctgctgctcacagctaacactttcagcccccag atccttgctcagccgggtactgtcccgaacacctgctgctttgctgtgaccaataagaag atcctcattcagcgactggagagctacagaataatcaccagcagcaaatgtccccagaca gctgtgatcttcaagaccaaactgaacaaggagatatgtgctgaccctaagcagaagtgg gttcagaactccataaagtacctggatcaaatctctcagactacaaagccatcatcacct ttcttgaaactaaccagagcctga

DBGET integrated database retrieval system