Heterocephalus glaber (naked mole-rat): 101699782 Help Entry 101699782         CDS       T02812                                  Symbol Ccl22 Name (RefSeq) C-C motif chemokine ligand 22   KO K21095   C-C motif chemokine 22 Organism hgl  Heterocephalus glaber (naked mole-rat) Pathway hgl04060   Cytokine-cytokine receptor interaction hgl04061   Viral protein interaction with cytokine and cytokine receptor hgl04062   Chemokine signaling pathway hgl04625   C-type lectin receptor signaling pathway Brite KEGG Orthology (KO) [BR:hgl00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     101699782 (Ccl22)    04061 Viral protein interaction with cytokine and cytokine receptor     101699782 (Ccl22)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     101699782 (Ccl22)    04062 Chemokine signaling pathway     101699782 (Ccl22)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:hgl04052]     101699782 (Ccl22) Cytokines and neuropeptides [BR:hgl04052]  Cytokines   Chemokines    101699782 (Ccl22) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  101699782 NCBI-ProteinID:  XP_004843231 UniProt:  G5AUE2 LinkDB All DBs Position Un AA seq 93 aa AA seqDB search MAGLQAPLLAGLVFLSVMLQATNAGPYGANVEDSICCRDFVRHPLPLRVVKDFYWTSGSC RRTGIVLQTVKDREICANPKLPWVKKILQKLSS NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atggccggcctacaggctccactcctggccggcctcgtcttcctttcggtgatgcttcag gcaaccaacgcagggccgtatggcgccaatgtggaggacagcatctgctgccgggacttc gtccgccaccccctgccgcttcgcgtggtgaaggacttctactggacctcgggctcctgc cgtaggactggcatcgtcttacaaaccgtcaaggaccgggagatctgtgccaaccccaaa ctgccctgggtaaagaagattctccagaagctgagctcatga

DBGET integrated database retrieval system