Heterocephalus glaber (naked mole-rat): 101701143 Help Entry 101701143         CDS       T02812                                  Name (RefSeq) ADP-ribosylation factor 6-like   KO K07941   ADP-ribosylation factor 6 Organism hgl  Heterocephalus glaber (naked mole-rat) Pathway hgl04014   Ras signaling pathway hgl04072   Phospholipase D signaling pathway hgl04144   Endocytosis hgl04666   Fc gamma R-mediated phagocytosis hgl05132   Salmonella infection hgl05135   Yersinia infection Brite KEGG Orthology (KO) [BR:hgl00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     101701143    04072 Phospholipase D signaling pathway     101701143  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     101701143  09150 Organismal Systems   09151 Immune system    04666 Fc gamma R-mediated phagocytosis     101701143  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     101701143    05135 Yersinia infection     101701143  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:hgl04131]     101701143   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hgl04147]     101701143    04031 GTP-binding proteins [BR:hgl04031]     101701143 Membrane trafficking [BR:hgl04131]  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     101701143   Arf GTPases and associated proteins    Arf GTPases     101701143 Exosome [BR:hgl04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    101701143   Exosomal proteins of colorectal cancer cells    101701143 GTP-binding proteins [BR:hgl04031]  Small (monomeric) G-proteins   Arf/Sar Family    Arf [OT]     101701143 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Arf Myelin_PLP Motif Other DBs NCBI-GeneID:  101701143 NCBI-ProteinID:  XP_012930205 UniProt:  A0AAX6QZC6 LinkDB All DBs Position Un AA seq 136 aa AA seqDB search MWIFMLGLDAACKTTILYKVNLGPSVTTIPTVGFHTESVTNKEFNTWDVGVNGRDKAKTL WRLYYCWTLIFLVDCAHQDHMEAARQELHHIINDQEVRDAIILDFANKQDLPDATNPLQI QEKLVLMGILHRNWFV NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atgtggatcttcatgttgggcctggacgcagcctgcaagacaaccatcctgtacaaggtg aacctgggcccatcagtgaccaccatccccacagtgggtttccacacagagagtgtgact aacaaagagttcaacacatgggatgtgggggtaaatggacgagacaaggcaaaaacgctc tggaggctttactactgctggacccttatctttctagtggactgcgcccaccaagaccac atggaggcggcccgccaggagctgcaccacattatcaatgaccaggaggtgagggacgcc attatcctcgactttgccaacaagcaggacctgccagatgccacgaacccgctgcagatc caggagaaactggtcctgatggggattctgcacaggaactggtttgtgtga

DBGET integrated database retrieval system