Heterocephalus glaber (naked mole-rat): 101701374 Help Entry 101701374         CDS       T02812                                  Symbol Cdc42 Name (RefSeq) cell division cycle 42   KO K04393   cell division control protein 42 Organism hgl  Heterocephalus glaber (naked mole-rat) Pathway hgl04010   MAPK signaling pathway hgl04014   Ras signaling pathway hgl04015   Rap1 signaling pathway hgl04062   Chemokine signaling pathway hgl04144   Endocytosis hgl04360   Axon guidance hgl04370   VEGF signaling pathway hgl04510   Focal adhesion hgl04520   Adherens junction hgl04530   Tight junction hgl04660   T cell receptor signaling pathway hgl04666   Fc gamma R-mediated phagocytosis hgl04670   Leukocyte transendothelial migration hgl04722   Neurotrophin signaling pathway hgl04810   Regulation of actin cytoskeleton hgl04912   GnRH signaling pathway hgl04932   Non-alcoholic fatty liver disease hgl04933   AGE-RAGE signaling pathway in diabetic complications hgl05100   Bacterial invasion of epithelial cells hgl05132   Salmonella infection hgl05135   Yersinia infection hgl05165   Human papillomavirus infection hgl05200   Pathways in cancer hgl05203   Viral carcinogenesis hgl05205   Proteoglycans in cancer hgl05211   Renal cell carcinoma hgl05212   Pancreatic cancer hgl05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:hgl00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     101701374 (Cdc42)    04014 Ras signaling pathway     101701374 (Cdc42)    04015 Rap1 signaling pathway     101701374 (Cdc42)    04370 VEGF signaling pathway     101701374 (Cdc42)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     101701374 (Cdc42)   09144 Cellular community - eukaryotes    04510 Focal adhesion     101701374 (Cdc42)    04520 Adherens junction     101701374 (Cdc42)    04530 Tight junction     101701374 (Cdc42)   09142 Cell motility    04810 Regulation of actin cytoskeleton     101701374 (Cdc42)  09150 Organismal Systems   09151 Immune system    04660 T cell receptor signaling pathway     101701374 (Cdc42)    04666 Fc gamma R-mediated phagocytosis     101701374 (Cdc42)    04670 Leukocyte transendothelial migration     101701374 (Cdc42)    04062 Chemokine signaling pathway     101701374 (Cdc42)   09152 Endocrine system    04912 GnRH signaling pathway     101701374 (Cdc42)   09156 Nervous system    04722 Neurotrophin signaling pathway     101701374 (Cdc42)   09158 Development and regeneration    04360 Axon guidance     101701374 (Cdc42)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     101701374 (Cdc42)    05205 Proteoglycans in cancer     101701374 (Cdc42)    05203 Viral carcinogenesis     101701374 (Cdc42)   09162 Cancer: specific types    05212 Pancreatic cancer     101701374 (Cdc42)    05211 Renal cell carcinoma     101701374 (Cdc42)   09172 Infectious disease: viral    05165 Human papillomavirus infection     101701374 (Cdc42)   09171 Infectious disease: bacterial    05132 Salmonella infection     101701374 (Cdc42)    05135 Yersinia infection     101701374 (Cdc42)    05100 Bacterial invasion of epithelial cells     101701374 (Cdc42)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     101701374 (Cdc42)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     101701374 (Cdc42)    04933 AGE-RAGE signaling pathway in diabetic complications     101701374 (Cdc42)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:hgl04131]     101701374 (Cdc42)    03036 Chromosome and associated proteins [BR:hgl03036]     101701374 (Cdc42)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hgl04147]     101701374 (Cdc42)    04031 GTP-binding proteins [BR:hgl04031]     101701374 (Cdc42) Membrane trafficking [BR:hgl04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     101701374 (Cdc42)  Endocytosis   Lipid raft mediated endocytosis    GRAF1-dependent endocytosis     101701374 (Cdc42)   Macropinocytosis    Ras GTPases     101701374 (Cdc42) Chromosome and associated proteins [BR:hgl03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     101701374 (Cdc42) Exosome [BR:hgl04147]  Exosomal proteins   Exosomal proteins of microglial cells    101701374 (Cdc42)   Exosomal proteins of breast milk    101701374 (Cdc42) GTP-binding proteins [BR:hgl04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     101701374 (Cdc42) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  101701374 NCBI-ProteinID:  XP_004850583 UniProt:  G5BI03 LinkDB All DBs Position Un AA seq 191 aa AA seqDB search MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG QEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLR DDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQRGLKNVFDEAILAALEPP ETQPKRKCCIF NT seq 576 nt NT seq  +upstreamnt  +downstreamnt atgcagacaattaagtgcgttgttgtgggcgatggtgctgttggtaaaacatgtctcctg atatcttatacaacaaacaaatttccatctgaatatgtaccaaccgtttttgacaactat gcagtcacagttatgattggtggagagccatatactcttgggctttttgatactgcagga caagaagattatgacagactacgaccattgagttatccacaaacagatgtatttctagtc tgtttttcagtggtctctccatcctcatttgaaaatgtgaaagaaaagtgggtgcctgag ataactcaccactgtccaaagactcctttcttgcttgttgggacccaaattgatctcaga gatgacccctctactattgagaaacttgccaagaacaaacagaaacctatcactccagag actgctgaaaagctggcccgagatctgaaggctgtcaagtatgtggagtgttctgcactc acacagagaggtctgaagaatgtgtttgatgaggctatcctagctgccctcgagcctccg gaaactcaacccaaaaggaagtgctgtatattctaa

DBGET integrated database retrieval system