Heterocephalus glaber (naked mole-rat): 101701441 Help Entry 101701441         CDS       T02812                                  Symbol Rheb Name (RefSeq) Ras homolog enriched in brain   KO K07208   Ras homolog enriched in brain Organism hgl  Heterocephalus glaber (naked mole-rat) Pathway hgl04072   Phospholipase D signaling pathway hgl04140   Autophagy - animal hgl04150   mTOR signaling pathway hgl04151   PI3K-Akt signaling pathway hgl04152   AMPK signaling pathway hgl04211   Longevity regulating pathway hgl04218   Cellular senescence hgl04714   Thermogenesis hgl04910   Insulin signaling pathway hgl04919   Thyroid hormone signaling pathway hgl05163   Human cytomegalovirus infection hgl05165   Human papillomavirus infection hgl05168   Herpes simplex virus 1 infection hgl05231   Choline metabolism in cancer Brite KEGG Orthology (KO) [BR:hgl00001]  09130 Environmental Information Processing   09132 Signal transduction    04072 Phospholipase D signaling pathway     101701441 (Rheb)    04151 PI3K-Akt signaling pathway     101701441 (Rheb)    04152 AMPK signaling pathway     101701441 (Rheb)    04150 mTOR signaling pathway     101701441 (Rheb)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     101701441 (Rheb)   09143 Cell growth and death    04218 Cellular senescence     101701441 (Rheb)  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     101701441 (Rheb)    04919 Thyroid hormone signaling pathway     101701441 (Rheb)   09149 Aging    04211 Longevity regulating pathway     101701441 (Rheb)   09159 Environmental adaptation    04714 Thermogenesis     101701441 (Rheb)  09160 Human Diseases   09161 Cancer: overview    05231 Choline metabolism in cancer     101701441 (Rheb)   09172 Infectious disease: viral    05168 Herpes simplex virus 1 infection     101701441 (Rheb)    05163 Human cytomegalovirus infection     101701441 (Rheb)    05165 Human papillomavirus infection     101701441 (Rheb)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:hgl04031]     101701441 (Rheb) GTP-binding proteins [BR:hgl04031]  Small (monomeric) G-proteins   Ras Family    Rheb     101701441 (Rheb) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase SRPRB AAA_14 RhoGAP_pG1_pG2 DUF1842 Motif Other DBs NCBI-GeneID:  101701441 NCBI-ProteinID:  XP_004860421 UniProt:  A0A0P6K201 LinkDB All DBs Position Un AA seq 184 aa AA seqDB search MPQSKSRKIAILGYRSVGKSSLTIQFVEGQFVDSYDPTIENTFTKLITVNGQEYHLQLVD TAGQDEYSIFPQTYSIDINGYILVYSVTSIKSFEVIKVIHGKLLDMVGKVQIPIMLVGNK KDLHMERVISYEEGKALAESWNAAFLESSAKENQTAVDVFRRIILEAEKMDGAASQGKSS CCVM NT seq 555 nt NT seq  +upstreamnt  +downstreamnt atgccgcagtcgaagtcccggaagatcgctatcctgggctaccggtctgtggggaaatcc tcattgacgattcagtttgttgaaggccaatttgttgactcctacgatccaaccatagaa aacactttcacaaagttgatcacagtaaatggacaagaatatcatcttcagcttgtagac acagctgggcaagatgaatattccatttttcctcagacatactccatagatattaatggc tacattcttgtgtattctgttacatcaattaaaagttttgaagtgatcaaagttatccat ggcaaattgttggatatggtggggaaagtgcaaatacctattatgctggttgggaataag aaagacctgcatatggaaagggtgatcagttacgaagaagggaaagctttggcagaatct tggaacgcggcctttttggaatcttctgctaaagaaaatcagactgcggtcgacgttttc agaaggataattttggaggcagaaaagatggacggggcagcttcccaaggcaagtcttcg tgctgcgtgatgtga

DBGET integrated database retrieval system