Heterocephalus glaber (naked mole-rat): 101702022 Help Entry 101702022         CDS       T02812                                  Symbol Fcer1g Name (RefSeq) Fc fragment of IgE receptor Ig   KO K07983   high affinity immunoglobulin epsilon receptor subunit gamma Organism hgl  Heterocephalus glaber (naked mole-rat) Pathway hgl04071   Sphingolipid signaling pathway hgl04072   Phospholipase D signaling pathway hgl04611   Platelet activation hgl04625   C-type lectin receptor signaling pathway hgl04650   Natural killer cell mediated cytotoxicity hgl04664   Fc epsilon RI signaling pathway hgl05152   Tuberculosis hgl05310   Asthma Brite KEGG Orthology (KO) [BR:hgl00001]  09130 Environmental Information Processing   09132 Signal transduction    04072 Phospholipase D signaling pathway     101702022 (Fcer1g)    04071 Sphingolipid signaling pathway     101702022 (Fcer1g)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     101702022 (Fcer1g)    04625 C-type lectin receptor signaling pathway     101702022 (Fcer1g)    04650 Natural killer cell mediated cytotoxicity     101702022 (Fcer1g)    04664 Fc epsilon RI signaling pathway     101702022 (Fcer1g)  09160 Human Diseases   09171 Infectious disease: bacterial    05152 Tuberculosis     101702022 (Fcer1g)   09163 Immune disease    05310 Asthma     101702022 (Fcer1g)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hgl04147]     101702022 (Fcer1g) Exosome [BR:hgl04147]  Exosomal proteins   Exosomal proteins of microglial cells    101702022 (Fcer1g) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  TCR_zetazeta ITAM Motif Other DBs NCBI-GeneID:  101702022 NCBI-ProteinID:  XP_004858720 LinkDB All DBs Position Un AA seq 87 aa AA seqDB search MMFPAVLLLLLLLVEQAAALGEPQLCYILDAILFLYGIILTLLYCRLKIQVRKAAIASFE KSDGIYTGLSTRNQETYETLKHEKPPQ NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgatgtttccagcagtgctcttactcttactccttttggttgaacaagcagcggccctg ggggagcctcagctctgctatatcctggatgccatcttgttcttgtatggtataatcctg actctgctctattgtcgactcaagatccaagtgcgaaaggcagctatagccagctttgag aaatcagatggcatttacacgggcctgagcacccggaaccaggagacttatgaaacactg aagcatgagaagccaccccagtaa

DBGET integrated database retrieval system