KEGG   Heterocephalus glaber (naked mole-rat): 101702687
Entry
101702687         CDS       T02812                                 
Symbol
Mapk3
Name
(RefSeq) mitogen-activated protein kinase 3
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
hgl  Heterocephalus glaber (naked mole-rat)
Pathway
hgl01521  EGFR tyrosine kinase inhibitor resistance
hgl01522  Endocrine resistance
hgl01524  Platinum drug resistance
hgl04010  MAPK signaling pathway
hgl04012  ErbB signaling pathway
hgl04014  Ras signaling pathway
hgl04015  Rap1 signaling pathway
hgl04022  cGMP-PKG signaling pathway
hgl04024  cAMP signaling pathway
hgl04062  Chemokine signaling pathway
hgl04066  HIF-1 signaling pathway
hgl04068  FoxO signaling pathway
hgl04071  Sphingolipid signaling pathway
hgl04072  Phospholipase D signaling pathway
hgl04114  Oocyte meiosis
hgl04140  Autophagy - animal
hgl04148  Efferocytosis
hgl04150  mTOR signaling pathway
hgl04151  PI3K-Akt signaling pathway
hgl04210  Apoptosis
hgl04218  Cellular senescence
hgl04261  Adrenergic signaling in cardiomyocytes
hgl04270  Vascular smooth muscle contraction
hgl04350  TGF-beta signaling pathway
hgl04360  Axon guidance
hgl04370  VEGF signaling pathway
hgl04371  Apelin signaling pathway
hgl04380  Osteoclast differentiation
hgl04510  Focal adhesion
hgl04517  IgSF CAM signaling
hgl04520  Adherens junction
hgl04540  Gap junction
hgl04550  Signaling pathways regulating pluripotency of stem cells
hgl04611  Platelet activation
hgl04613  Neutrophil extracellular trap formation
hgl04620  Toll-like receptor signaling pathway
hgl04621  NOD-like receptor signaling pathway
hgl04625  C-type lectin receptor signaling pathway
hgl04650  Natural killer cell mediated cytotoxicity
hgl04657  IL-17 signaling pathway
hgl04658  Th1 and Th2 cell differentiation
hgl04659  Th17 cell differentiation
hgl04660  T cell receptor signaling pathway
hgl04662  B cell receptor signaling pathway
hgl04664  Fc epsilon RI signaling pathway
hgl04666  Fc gamma R-mediated phagocytosis
hgl04668  TNF signaling pathway
hgl04713  Circadian entrainment
hgl04720  Long-term potentiation
hgl04722  Neurotrophin signaling pathway
hgl04723  Retrograde endocannabinoid signaling
hgl04724  Glutamatergic synapse
hgl04725  Cholinergic synapse
hgl04726  Serotonergic synapse
hgl04730  Long-term depression
hgl04810  Regulation of actin cytoskeleton
hgl04910  Insulin signaling pathway
hgl04912  GnRH signaling pathway
hgl04914  Progesterone-mediated oocyte maturation
hgl04915  Estrogen signaling pathway
hgl04916  Melanogenesis
hgl04917  Prolactin signaling pathway
hgl04919  Thyroid hormone signaling pathway
hgl04921  Oxytocin signaling pathway
hgl04926  Relaxin signaling pathway
hgl04928  Parathyroid hormone synthesis, secretion and action
hgl04929  GnRH secretion
hgl04930  Type II diabetes mellitus
hgl04933  AGE-RAGE signaling pathway in diabetic complications
hgl04934  Cushing syndrome
hgl04935  Growth hormone synthesis, secretion and action
hgl04960  Aldosterone-regulated sodium reabsorption
hgl05010  Alzheimer disease
hgl05020  Prion disease
hgl05022  Pathways of neurodegeneration - multiple diseases
hgl05034  Alcoholism
hgl05132  Salmonella infection
hgl05133  Pertussis
hgl05135  Yersinia infection
hgl05140  Leishmaniasis
hgl05142  Chagas disease
hgl05145  Toxoplasmosis
hgl05152  Tuberculosis
hgl05160  Hepatitis C
hgl05161  Hepatitis B
hgl05163  Human cytomegalovirus infection
hgl05164  Influenza A
hgl05165  Human papillomavirus infection
hgl05166  Human T-cell leukemia virus 1 infection
hgl05167  Kaposi sarcoma-associated herpesvirus infection
hgl05170  Human immunodeficiency virus 1 infection
hgl05171  Coronavirus disease - COVID-19
hgl05200  Pathways in cancer
hgl05203  Viral carcinogenesis
hgl05205  Proteoglycans in cancer
hgl05206  MicroRNAs in cancer
hgl05207  Chemical carcinogenesis - receptor activation
hgl05208  Chemical carcinogenesis - reactive oxygen species
hgl05210  Colorectal cancer
hgl05211  Renal cell carcinoma
hgl05212  Pancreatic cancer
hgl05213  Endometrial cancer
hgl05214  Glioma
hgl05215  Prostate cancer
hgl05216  Thyroid cancer
hgl05218  Melanoma
hgl05219  Bladder cancer
hgl05220  Chronic myeloid leukemia
hgl05221  Acute myeloid leukemia
hgl05223  Non-small cell lung cancer
hgl05224  Breast cancer
hgl05225  Hepatocellular carcinoma
hgl05226  Gastric cancer
hgl05230  Central carbon metabolism in cancer
hgl05231  Choline metabolism in cancer
hgl05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
hgl05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101702687 (Mapk3)
   04012 ErbB signaling pathway
    101702687 (Mapk3)
   04014 Ras signaling pathway
    101702687 (Mapk3)
   04015 Rap1 signaling pathway
    101702687 (Mapk3)
   04350 TGF-beta signaling pathway
    101702687 (Mapk3)
   04370 VEGF signaling pathway
    101702687 (Mapk3)
   04371 Apelin signaling pathway
    101702687 (Mapk3)
   04668 TNF signaling pathway
    101702687 (Mapk3)
   04066 HIF-1 signaling pathway
    101702687 (Mapk3)
   04068 FoxO signaling pathway
    101702687 (Mapk3)
   04072 Phospholipase D signaling pathway
    101702687 (Mapk3)
   04071 Sphingolipid signaling pathway
    101702687 (Mapk3)
   04024 cAMP signaling pathway
    101702687 (Mapk3)
   04022 cGMP-PKG signaling pathway
    101702687 (Mapk3)
   04151 PI3K-Akt signaling pathway
    101702687 (Mapk3)
   04150 mTOR signaling pathway
    101702687 (Mapk3)
  09133 Signaling molecules and interaction
   04517 IgSF CAM signaling
    101702687 (Mapk3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101702687 (Mapk3)
   04148 Efferocytosis
    101702687 (Mapk3)
  09143 Cell growth and death
   04114 Oocyte meiosis
    101702687 (Mapk3)
   04210 Apoptosis
    101702687 (Mapk3)
   04218 Cellular senescence
    101702687 (Mapk3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101702687 (Mapk3)
   04520 Adherens junction
    101702687 (Mapk3)
   04540 Gap junction
    101702687 (Mapk3)
   04550 Signaling pathways regulating pluripotency of stem cells
    101702687 (Mapk3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101702687 (Mapk3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101702687 (Mapk3)
   04613 Neutrophil extracellular trap formation
    101702687 (Mapk3)
   04620 Toll-like receptor signaling pathway
    101702687 (Mapk3)
   04621 NOD-like receptor signaling pathway
    101702687 (Mapk3)
   04625 C-type lectin receptor signaling pathway
    101702687 (Mapk3)
   04650 Natural killer cell mediated cytotoxicity
    101702687 (Mapk3)
   04660 T cell receptor signaling pathway
    101702687 (Mapk3)
   04658 Th1 and Th2 cell differentiation
    101702687 (Mapk3)
   04659 Th17 cell differentiation
    101702687 (Mapk3)
   04657 IL-17 signaling pathway
    101702687 (Mapk3)
   04662 B cell receptor signaling pathway
    101702687 (Mapk3)
   04664 Fc epsilon RI signaling pathway
    101702687 (Mapk3)
   04666 Fc gamma R-mediated phagocytosis
    101702687 (Mapk3)
   04062 Chemokine signaling pathway
    101702687 (Mapk3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101702687 (Mapk3)
   04929 GnRH secretion
    101702687 (Mapk3)
   04912 GnRH signaling pathway
    101702687 (Mapk3)
   04915 Estrogen signaling pathway
    101702687 (Mapk3)
   04914 Progesterone-mediated oocyte maturation
    101702687 (Mapk3)
   04917 Prolactin signaling pathway
    101702687 (Mapk3)
   04921 Oxytocin signaling pathway
    101702687 (Mapk3)
   04926 Relaxin signaling pathway
    101702687 (Mapk3)
   04935 Growth hormone synthesis, secretion and action
    101702687 (Mapk3)
   04919 Thyroid hormone signaling pathway
    101702687 (Mapk3)
   04928 Parathyroid hormone synthesis, secretion and action
    101702687 (Mapk3)
   04916 Melanogenesis
    101702687 (Mapk3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101702687 (Mapk3)
   04270 Vascular smooth muscle contraction
    101702687 (Mapk3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    101702687 (Mapk3)
  09156 Nervous system
   04724 Glutamatergic synapse
    101702687 (Mapk3)
   04725 Cholinergic synapse
    101702687 (Mapk3)
   04726 Serotonergic synapse
    101702687 (Mapk3)
   04720 Long-term potentiation
    101702687 (Mapk3)
   04730 Long-term depression
    101702687 (Mapk3)
   04723 Retrograde endocannabinoid signaling
    101702687 (Mapk3)
   04722 Neurotrophin signaling pathway
    101702687 (Mapk3)
  09158 Development and regeneration
   04360 Axon guidance
    101702687 (Mapk3)
   04380 Osteoclast differentiation
    101702687 (Mapk3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    101702687 (Mapk3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101702687 (Mapk3)
   05206 MicroRNAs in cancer
    101702687 (Mapk3)
   05205 Proteoglycans in cancer
    101702687 (Mapk3)
   05207 Chemical carcinogenesis - receptor activation
    101702687 (Mapk3)
   05208 Chemical carcinogenesis - reactive oxygen species
    101702687 (Mapk3)
   05203 Viral carcinogenesis
    101702687 (Mapk3)
   05230 Central carbon metabolism in cancer
    101702687 (Mapk3)
   05231 Choline metabolism in cancer
    101702687 (Mapk3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101702687 (Mapk3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101702687 (Mapk3)
   05212 Pancreatic cancer
    101702687 (Mapk3)
   05225 Hepatocellular carcinoma
    101702687 (Mapk3)
   05226 Gastric cancer
    101702687 (Mapk3)
   05214 Glioma
    101702687 (Mapk3)
   05216 Thyroid cancer
    101702687 (Mapk3)
   05221 Acute myeloid leukemia
    101702687 (Mapk3)
   05220 Chronic myeloid leukemia
    101702687 (Mapk3)
   05218 Melanoma
    101702687 (Mapk3)
   05211 Renal cell carcinoma
    101702687 (Mapk3)
   05219 Bladder cancer
    101702687 (Mapk3)
   05215 Prostate cancer
    101702687 (Mapk3)
   05213 Endometrial cancer
    101702687 (Mapk3)
   05224 Breast cancer
    101702687 (Mapk3)
   05223 Non-small cell lung cancer
    101702687 (Mapk3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101702687 (Mapk3)
   05170 Human immunodeficiency virus 1 infection
    101702687 (Mapk3)
   05161 Hepatitis B
    101702687 (Mapk3)
   05160 Hepatitis C
    101702687 (Mapk3)
   05171 Coronavirus disease - COVID-19
    101702687 (Mapk3)
   05164 Influenza A
    101702687 (Mapk3)
   05163 Human cytomegalovirus infection
    101702687 (Mapk3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101702687 (Mapk3)
   05165 Human papillomavirus infection
    101702687 (Mapk3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101702687 (Mapk3)
   05135 Yersinia infection
    101702687 (Mapk3)
   05133 Pertussis
    101702687 (Mapk3)
   05152 Tuberculosis
    101702687 (Mapk3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101702687 (Mapk3)
   05140 Leishmaniasis
    101702687 (Mapk3)
   05142 Chagas disease
    101702687 (Mapk3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101702687 (Mapk3)
   05020 Prion disease
    101702687 (Mapk3)
   05022 Pathways of neurodegeneration - multiple diseases
    101702687 (Mapk3)
  09165 Substance dependence
   05034 Alcoholism
    101702687 (Mapk3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    101702687 (Mapk3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    101702687 (Mapk3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101702687 (Mapk3)
   04934 Cushing syndrome
    101702687 (Mapk3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101702687 (Mapk3)
   01524 Platinum drug resistance
    101702687 (Mapk3)
   01522 Endocrine resistance
    101702687 (Mapk3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hgl01001]
    101702687 (Mapk3)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hgl03036]
    101702687 (Mapk3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hgl04147]
    101702687 (Mapk3)
Enzymes [BR:hgl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     101702687 (Mapk3)
Protein kinases [BR:hgl01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   101702687 (Mapk3)
Chromosome and associated proteins [BR:hgl03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     101702687 (Mapk3)
Exosome [BR:hgl04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101702687 (Mapk3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH Haspin_kinase FTA2 Kdo
Other DBs
NCBI-GeneID: 101702687
NCBI-ProteinID: XP_004856331
UniProt: A0AAX6PPW7
LinkDB
Position
Un
AA seq 378 aa
MAAAAQGGGGGEPRGAGGVGPGVPGEVEVVKGQPFDVGPRYTQLQYIGEGAYGMVSSAYD
HVLKTRVAIKKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRAPTLEAMRDVYIV
QDLMETDLYKLLKSQQLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCDLK
ICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSN
RPIFPGKHYLDQLNHILGILGSPSQEDLNCIINTKARNYLQSLPSKTKVAWAKLFPKSDS
KALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFDMELDDLPKERLK
ELIFQETARFQPGAQDVP
NT seq 1137 nt   +upstreamnt  +downstreamnt
atggcggcggctgctcaggggggcgggggcggggagccccggggagccggcggggtgggc
ccgggggtcccgggggaagtggaggtggtgaagggccagccgttcgacgtgggcccgcgc
tacacgcagctgcagtacatcggcgagggagcctacggcatggtcagctcagcgtatgac
cacgtgctcaagactcgagtggccataaagaaaatcagccccttcgagcatcagacctac
tgccagcgaacactacgggagatccagatcttgctgcgcttccgccacgagaatgtcata
ggcatccgagatattcttcgggcgcctaccctggaagccatgagagatgtgtacattgtg
caggacctgatggagacagacctgtacaagttgctcaaaagccagcagctgagcaatgac
catatctgctacttcctctaccagatccttcggggcctcaagtatatccactcagccaat
gtactccaccgggatctaaagccctccaacctgctcatcaacaccacctgcgaccttaag
atctgtgatttcggcctggcccggattgctgatcctgagcatgaccacactggctttctg
accgaatatgtggccacacgctggtaccgggctccggagatcatgcttaactccaagggc
tataccaaatccattgacatctggtctgtgggctgcattctggctgagatgctctccaac
cgacccatcttccccggcaagcactacctggaccagctcaaccacattctgggtatcctg
ggctccccatcccaggaggacctgaattgtatcattaacacgaaggcccggaactaccta
cagtctctgccctctaagaccaaggtggcctgggccaagctttttcccaagtcagactcc
aaagctcttgacctcctggacaggatgttaaccttcaaccccaataagcggatcacagtg
gaggaggccctggctcacccctacctggagcagtactatgaccccacagatgagccagtg
gctgaggagcccttcactttcgacatggagctggatgatctgcccaaggagcggctgaag
gagcttatcttccaagagacagcccgctttcagccaggggcgcaagacgtcccctaa

DBGET integrated database retrieval system