Heterocephalus glaber (naked mole-rat): 101703043 Help Entry 101703043         CDS       T02812                                  Symbol Gnai3 Name (RefSeq) G protein subunit alpha i3   KO K04630   guanine nucleotide-binding protein G(i) subunit alpha Organism hgl  Heterocephalus glaber (naked mole-rat) Pathway hgl04015   Rap1 signaling pathway hgl04022   cGMP-PKG signaling pathway hgl04024   cAMP signaling pathway hgl04062   Chemokine signaling pathway hgl04071   Sphingolipid signaling pathway hgl04081   Hormone signaling hgl04082   Neuroactive ligand signaling hgl04261   Adrenergic signaling in cardiomyocytes hgl04360   Axon guidance hgl04371   Apelin signaling pathway hgl04540   Gap junction hgl04611   Platelet activation hgl04670   Leukocyte transendothelial migration hgl04713   Circadian entrainment hgl04723   Retrograde endocannabinoid signaling hgl04724   Glutamatergic synapse hgl04725   Cholinergic synapse hgl04726   Serotonergic synapse hgl04727   GABAergic synapse hgl04728   Dopaminergic synapse hgl04730   Long-term depression hgl04914   Progesterone-mediated oocyte maturation hgl04915   Estrogen signaling pathway hgl04916   Melanogenesis hgl04921   Oxytocin signaling pathway hgl04923   Regulation of lipolysis in adipocytes hgl04924   Renin secretion hgl04926   Relaxin signaling pathway hgl04928   Parathyroid hormone synthesis, secretion and action hgl04934   Cushing syndrome hgl04935   Growth hormone synthesis, secretion and action hgl04971   Gastric acid secretion hgl05012   Parkinson disease hgl05030   Cocaine addiction hgl05032   Morphine addiction hgl05034   Alcoholism hgl05133   Pertussis hgl05142   Chagas disease hgl05145   Toxoplasmosis hgl05163   Human cytomegalovirus infection hgl05170   Human immunodeficiency virus 1 infection hgl05200   Pathways in cancer hgl05207   Chemical carcinogenesis - receptor activation Brite KEGG Orthology (KO) [BR:hgl00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     101703043 (Gnai3)    04371 Apelin signaling pathway     101703043 (Gnai3)    04071 Sphingolipid signaling pathway     101703043 (Gnai3)    04024 cAMP signaling pathway     101703043 (Gnai3)    04022 cGMP-PKG signaling pathway     101703043 (Gnai3)   09133 Signaling molecules and interaction    04082 Neuroactive ligand signaling     101703043 (Gnai3)    04081 Hormone signaling     101703043 (Gnai3)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04540 Gap junction     101703043 (Gnai3)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     101703043 (Gnai3)    04670 Leukocyte transendothelial migration     101703043 (Gnai3)    04062 Chemokine signaling pathway     101703043 (Gnai3)   09152 Endocrine system    04923 Regulation of lipolysis in adipocytes     101703043 (Gnai3)    04915 Estrogen signaling pathway     101703043 (Gnai3)    04914 Progesterone-mediated oocyte maturation     101703043 (Gnai3)    04921 Oxytocin signaling pathway     101703043 (Gnai3)    04926 Relaxin signaling pathway     101703043 (Gnai3)    04935 Growth hormone synthesis, secretion and action     101703043 (Gnai3)    04928 Parathyroid hormone synthesis, secretion and action     101703043 (Gnai3)    04916 Melanogenesis     101703043 (Gnai3)    04924 Renin secretion     101703043 (Gnai3)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     101703043 (Gnai3)   09154 Digestive system    04971 Gastric acid secretion     101703043 (Gnai3)   09156 Nervous system    04724 Glutamatergic synapse     101703043 (Gnai3)    04727 GABAergic synapse     101703043 (Gnai3)    04725 Cholinergic synapse     101703043 (Gnai3)    04728 Dopaminergic synapse     101703043 (Gnai3)    04726 Serotonergic synapse     101703043 (Gnai3)    04730 Long-term depression     101703043 (Gnai3)    04723 Retrograde endocannabinoid signaling     101703043 (Gnai3)   09158 Development and regeneration    04360 Axon guidance     101703043 (Gnai3)   09159 Environmental adaptation    04713 Circadian entrainment     101703043 (Gnai3)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     101703043 (Gnai3)    05207 Chemical carcinogenesis - receptor activation     101703043 (Gnai3)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     101703043 (Gnai3)    05163 Human cytomegalovirus infection     101703043 (Gnai3)   09171 Infectious disease: bacterial    05133 Pertussis     101703043 (Gnai3)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     101703043 (Gnai3)    05142 Chagas disease     101703043 (Gnai3)   09164 Neurodegenerative disease    05012 Parkinson disease     101703043 (Gnai3)   09165 Substance dependence    05030 Cocaine addiction     101703043 (Gnai3)    05032 Morphine addiction     101703043 (Gnai3)    05034 Alcoholism     101703043 (Gnai3)   09167 Endocrine and metabolic disease    04934 Cushing syndrome     101703043 (Gnai3)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hgl04147]     101703043 (Gnai3)    04031 GTP-binding proteins [BR:hgl04031]     101703043 (Gnai3) Exosome [BR:hgl04147]  Exosomal proteins   Proteins found in most exosomes    101703043 (Gnai3) GTP-binding proteins [BR:hgl04031]  Heterotrimeric G-proteins   Alpha Subunits    Alpha type 1 (Gi/o) [OT]     101703043 (Gnai3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  G-alpha Arf Gtr1_RagA Roc TniB FtsK_SpoIIIE AAA_29 Motif Other DBs NCBI-GeneID:  101703043 NCBI-ProteinID:  XP_004853697 UniProt:  A0AAX6PL95 LinkDB All DBs Position Un AA seq 354 aa AA seqDB search MGCTLSAEDKAAVERSKMIDRNLREDGEKAAKEVKLLLLGAGESGKSTIVKQMKIIHEDG YSEEECKQYKVVVYSNTIQSIIAIIRAMGRLKIDFGEAARADDARQLFVLAGSAEEGIMT SELAGVIKRLWRDGGVQACFSRSREYQLNDSASYYLNDLDRISQTSYIPTQQDVLRTRVK TTGIVETHFTFKDLYFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEM NRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKRSPLTICYPEYTGSNTYEEAA AYIQCQFEDLNRRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKECGLY NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt atgggctgcacactgagcgccgaagacaaggcggcggtggagcggagtaagatgatcgac cgcaatttgcgggaggacggggagaaagctgccaaagaagtgaagctgctgttactcggt gctggagaatctggtaaaagtaccattgtgaaacagatgaaaatcattcatgaagacggc tattcagaagaagaatgtaaacaatataaagtagttgtctacagcaatactatacagtcc atcattgcaatcataagagccatgggacggctaaagattgattttggggaagctgccaga gcagatgatgctcggcagttatttgttttagctggcagtgctgaagaaggaatcatgact tcagaactcgcaggagtgattaaacggttatggcgagatggtggggtccaggcatgcttt agcagatccagggaatatcagctcaatgattctgcctcatattacctaaatgatttggat agaatatcacaaaccagctacattccaactcagcaagatgttcttcggacaagagtgaag accacaggcattgtggaaacacatttcaccttcaaagacctatacttcaagatgtttgat gttggtggccaaagatcagaacgaaaaaaatggattcactgttttgagggagtgacagca attatcttctgtgtggccctcagtgattatgaccttgttttagctgaggatgaggagatg aaccgaatgcatgaaagcatgaaactgttcgacagcatttgtaacaacaaatggtttaca gacacttcaatcattctcttccttaacaagaaagacctttttgaagaaaaaataaagagg agtccattaactatctgttatccagaatatacaggttctaatacatatgaagaggcagct gcttacattcagtgccagtttgaagatttgaacagaaggaaagataccaaggagatctat actcacttcacctgtgccacagacaccaagaatgtgcagtttgtttttgatgctgttaca gatgtcatcattaaaaacaacttaaaggaatgtggactttattga

DBGET integrated database retrieval system