Heterocephalus glaber (naked mole-rat): 101703643 Help Entry 101703643         CDS       T02812                                  Name (RefSeq) ras-related protein Rab-7a   KO K07897   Ras-related protein Rab-7A Organism hgl  Heterocephalus glaber (naked mole-rat) Pathway hgl04137   Mitophagy - animal hgl04140   Autophagy - animal hgl04144   Endocytosis hgl04145   Phagosome hgl04148   Efferocytosis hgl05132   Salmonella infection hgl05146   Amoebiasis hgl05152   Tuberculosis Brite KEGG Orthology (KO) [BR:hgl00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     101703643    04145 Phagosome     101703643    04140 Autophagy - animal     101703643    04137 Mitophagy - animal     101703643    04148 Efferocytosis     101703643  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     101703643    05152 Tuberculosis     101703643   09174 Infectious disease: parasitic    05146 Amoebiasis     101703643  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:hgl04131]     101703643   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hgl04147]     101703643    04031 GTP-binding proteins [BR:hgl04031]     101703643 Membrane trafficking [BR:hgl04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     101703643 Exosome [BR:hgl04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    101703643   Exosomal proteins of other body fluids (saliva and urine)    101703643   Exosomal proteins of colorectal cancer cells    101703643   Exosomal proteins of bladder cancer cells    101703643 GTP-binding proteins [BR:hgl04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     101703643 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase Gtr1_RagA cobW ATP_bind_1 nSTAND3 PduV-EutP Septin AAA_7 NTPase_1 AAA_22 AAA_16 AAA_24 AAA_5 G-alpha ATPase_2 NACHT AAA_14 NB-ARC SRPRB ATP-synt_ab MCM DAP3 ABC_tran Motif Other DBs NCBI-GeneID:  101703643 NCBI-ProteinID:  XP_004875528 UniProt:  A0A0P6J0P5 LinkDB All DBs Position Un AA seq 201 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVATKRAQAWCYSKNNIPYFETSAKEAINVEQAFQTIARNALKQVGPG CLCHPPGVTVSSAAFLGAPPL NT seq 606 nt NT seq  +upstreamnt  +downstreamnt atgacctcgaggaagaaagtgttactgaaggttatcatcctgggcgattcgggggtcggc aagacatcacttatgaaccagtatgtgaacaagaaattcagtaaccagtacaaagccaca ataggagcagacttcctgaccaaggaggtgatggtggatgacagactagtcaccatgcag atatgggacacggccggtcaggaaaggttccagtccctcggcgtggccttctaccgaggc gcggattgctgcgtgctggtgtttgatgtgacagctcccaacacgttcaagaccctggac agctggagagatgagttcctcatccaggccagcccccgggacccagagaacttccccttt gtcgtgctggggaacaagatcgacctcgaaaacagacaagtggccacgaagagggcacaa gcctggtgctacagcaaaaacaacattccctactttgagaccagtgccaaggaggccatc aatgtggagcaggcgttccagacgattgcacggaatgcgctcaagcaggtaggtcctggc tgtctctgccaccctcctggggtgacggtgagctccgctgcgttcctgggagcgccccca ctctga

DBGET integrated database retrieval system