Heterocephalus glaber (naked mole-rat): 101703933 Help Entry 101703933         CDS       T02812                                  Symbol Il1a Name (RefSeq) interleukin 1 alpha   KO K04383   interleukin 1 alpha Organism hgl  Heterocephalus glaber (naked mole-rat) Pathway hgl04010   MAPK signaling pathway hgl04060   Cytokine-cytokine receptor interaction hgl04217   Necroptosis hgl04218   Cellular senescence hgl04380   Osteoclast differentiation hgl04640   Hematopoietic cell lineage hgl04932   Non-alcoholic fatty liver disease hgl04933   AGE-RAGE signaling pathway in diabetic complications hgl04940   Type I diabetes mellitus hgl05010   Alzheimer disease hgl05020   Prion disease hgl05022   Pathways of neurodegeneration - multiple diseases hgl05133   Pertussis hgl05140   Leishmaniasis hgl05152   Tuberculosis hgl05162   Measles hgl05164   Influenza A hgl05321   Inflammatory bowel disease hgl05323   Rheumatoid arthritis hgl05332   Graft-versus-host disease hgl05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:hgl00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     101703933 (Il1a)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     101703933 (Il1a)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     101703933 (Il1a)    04218 Cellular senescence     101703933 (Il1a)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     101703933 (Il1a)   09158 Development and regeneration    04380 Osteoclast differentiation     101703933 (Il1a)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     101703933 (Il1a)    05162 Measles     101703933 (Il1a)   09171 Infectious disease: bacterial    05133 Pertussis     101703933 (Il1a)    05152 Tuberculosis     101703933 (Il1a)   09174 Infectious disease: parasitic    05140 Leishmaniasis     101703933 (Il1a)   09163 Immune disease    05323 Rheumatoid arthritis     101703933 (Il1a)    05321 Inflammatory bowel disease     101703933 (Il1a)    05332 Graft-versus-host disease     101703933 (Il1a)   09164 Neurodegenerative disease    05010 Alzheimer disease     101703933 (Il1a)    05020 Prion disease     101703933 (Il1a)    05022 Pathways of neurodegeneration - multiple diseases     101703933 (Il1a)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     101703933 (Il1a)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     101703933 (Il1a)    04932 Non-alcoholic fatty liver disease     101703933 (Il1a)    04933 AGE-RAGE signaling pathway in diabetic complications     101703933 (Il1a)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:hgl04052]     101703933 (Il1a) Cytokines and neuropeptides [BR:hgl04052]  Cytokines   Interleukins    101703933 (Il1a) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL1_propep IL1 Motif Other DBs NCBI-GeneID:  101703933 NCBI-ProteinID:  XP_004844586 UniProt:  A0A0N8EUI7 LinkDB All DBs Position Un AA seq 271 aa AA seqDB search MAEIPNLFEDLKSCYSENEEYASAIDHLSLNQKSFYDTSYGPLDKNCMNTSMSLRTLETS EASELTFKKNLVVVSTSAHGTVLKKRWLSLNQTITNEDLDAIANDPEEEIIKPQSAPHTL QSNVRYKYMRILRKEFVLSDSIHQSITLDATGQYLRAVALTDLSQEAVKFDMGGYISATD DNTNPVTLRISKTRLFVSAQEEDQPMLLKEMPETPKIITGNELNLLFFWENERGHNFFRS AANSELLIATKEDSLVHMARGSSSMTDFQIS NT seq 816 nt NT seq  +upstreamnt  +downstreamnt atggccgaaattccgaacctgttcgaagacctgaagagctgttacagtgaaaatgaagaa tatgcttctgccattgaccatctctctctgaatcagaaatccttctatgacacaagctat ggcccacttgacaagaactgcatgaatacatccatgtctctgagaacacttgaaacctct gaagcatctgagcttaccttcaagaagaacttggtggtggtgtcaacgtcagcccatggg acagttctgaagaagagatggctgagcttaaatcaaaccattactaatgaagatctggac gccatcgccaatgatccagaagaagaaatcatcaagccgcagtcagcacctcacaccctc cagagcaatgtgagatacaaatacatgaggattctcaggaaggaatttgtcctaagtgat tccattcatcaaagtataactctagatgcgacgggtcaatacctcagggctgttgcatta actgacctgagccaggaagctgtgaaatttgacatgggtggctacatatcagcaacagat gataatacaaatcctgtgactttaagaatctcaaaaacccgactgtttgtgagtgcccaa gaagaagaccagcccatgttgctgaaggagatgcctgagacaccaaaaatcatcacaggt aatgagctcaacctgctcttcttctgggaaaatgaaagaggtcataacttcttcaggtca gctgccaattcagagctgctcattgccacaaaggaagacagtctggtgcacatggccagg ggatcatcctctatgacagactttcagatatcctaa

DBGET integrated database retrieval system