Heterocephalus glaber (naked mole-rat): 101704951 Help Entry 101704951         CDS       T02812                                  Symbol Cd24 Name (RefSeq) CD24 molecule   KO K06469   CD24 antigen Organism hgl  Heterocephalus glaber (naked mole-rat) Pathway hgl04148   Efferocytosis hgl04640   Hematopoietic cell lineage Brite KEGG Orthology (KO) [BR:hgl00001]  09140 Cellular Processes   09141 Transport and catabolism    04148 Efferocytosis     101704951 (Cd24)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     101704951 (Cd24)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04090 CD molecules [BR:hgl04090]     101704951 (Cd24)    00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hgl00537]     101704951 (Cd24) CD molecules [BR:hgl04090]  Proteins   101704951 (Cd24) Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hgl00537]  Antigens   101704951 (Cd24) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CD24 Wzz Cytomega_UL20A Motif Other DBs NCBI-GeneID:  101704951 NCBI-ProteinID:  XP_004855492 UniProt:  G5BMN9 LinkDB All DBs Position Un AA seq 78 aa AA seqDB search MGRAMVARLGLGLLLLALLLPTQIYSNQTAVVQPSSNTSQNTSTTPNPTNATTKAGNGAL QSTASLLVVSISLLHLYC NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgggcagagcgatggtggccaggctggggctggggctgctgctcttggcactgctccta cccacgcagatttactcaaaccaaacagctgttgtgcaaccttcaagtaacacctcccag aacacctctactaccccaaatccaactaatgccaccaccaaggcaggcaacggtgccctg cagtcgacagccagtctccttgtggtctcgatctctcttctacatctgtactgttag

DBGET integrated database retrieval system