Heterocephalus glaber (naked mole-rat): 101704956 Help Entry 101704956         CDS       T02812                                  Name (RefSeq) cytochrome c   KO K08738   cytochrome c Organism hgl  Heterocephalus glaber (naked mole-rat) Pathway hgl00190   Oxidative phosphorylation hgl01100   Metabolic pathways hgl01524   Platinum drug resistance hgl04115   p53 signaling pathway hgl04210   Apoptosis hgl04215   Apoptosis - multiple species hgl04932   Non-alcoholic fatty liver disease hgl05010   Alzheimer disease hgl05012   Parkinson disease hgl05014   Amyotrophic lateral sclerosis hgl05016   Huntington disease hgl05017   Spinocerebellar ataxia hgl05020   Prion disease hgl05022   Pathways of neurodegeneration - multiple diseases hgl05132   Salmonella infection hgl05134   Legionellosis hgl05145   Toxoplasmosis hgl05152   Tuberculosis hgl05160   Hepatitis C hgl05161   Hepatitis B hgl05162   Measles hgl05163   Human cytomegalovirus infection hgl05164   Influenza A hgl05167   Kaposi sarcoma-associated herpesvirus infection hgl05168   Herpes simplex virus 1 infection hgl05169   Epstein-Barr virus infection hgl05170   Human immunodeficiency virus 1 infection hgl05200   Pathways in cancer hgl05210   Colorectal cancer hgl05222   Small cell lung cancer hgl05416   Viral myocarditis hgl05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:hgl00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     101704956  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     101704956    04215 Apoptosis - multiple species     101704956    04115 p53 signaling pathway     101704956  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     101704956   09162 Cancer: specific types    05210 Colorectal cancer     101704956    05222 Small cell lung cancer     101704956   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     101704956    05161 Hepatitis B     101704956    05160 Hepatitis C     101704956    05164 Influenza A     101704956    05162 Measles     101704956    05168 Herpes simplex virus 1 infection     101704956    05163 Human cytomegalovirus infection     101704956    05167 Kaposi sarcoma-associated herpesvirus infection     101704956    05169 Epstein-Barr virus infection     101704956   09171 Infectious disease: bacterial    05132 Salmonella infection     101704956    05134 Legionellosis     101704956    05152 Tuberculosis     101704956   09174 Infectious disease: parasitic    05145 Toxoplasmosis     101704956   09164 Neurodegenerative disease    05010 Alzheimer disease     101704956    05012 Parkinson disease     101704956    05014 Amyotrophic lateral sclerosis     101704956    05016 Huntington disease     101704956    05017 Spinocerebellar ataxia     101704956    05020 Prion disease     101704956    05022 Pathways of neurodegeneration - multiple diseases     101704956   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     101704956    05416 Viral myocarditis     101704956   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     101704956   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     101704956 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 CCP_MauG Motif Other DBs NCBI-GeneID:  101704956 NCBI-ProteinID:  XP_004836182 UniProt:  G5AWV4 LinkDB All DBs Position Un AA seq 104 aa AA seqDB search MGDVEKGKNIFVQNCARCHTVEKGGKHKTGPNLHGLFGQKTGQAVGFSYTDANKNKGITW GEDTLMEYLENPKKYIPGTKMIFAGIKKGERADLRAYLKKAPNE NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atgggtgatgttgagaaaggcaagaatatttttgtacagaattgtgccaggtgccacact gtggagaagggaggcaagcacaagactgggccaaatctccatggtctgtttgggcagaag acaggtcaagctgttggattctcttacacagatgccaacaagaacaaaggcatcacctgg ggagaggatacactgatggagtacttggagaatcccaagaagtacatccctggaacaaaa atgatcttcgctggcattaagaagggagaaagggcagacttaagagcttatctcaaaaaa gctcctaatgagtaa

DBGET integrated database retrieval system