Heterocephalus glaber (naked mole-rat): 101705159 Help Entry 101705159         CDS       T02812                                  Symbol Cdc26 Name (RefSeq) cell division cycle 26   KO K03359   anaphase-promoting complex subunit 12 Organism hgl  Heterocephalus glaber (naked mole-rat) Pathway hgl04110   Cell cycle hgl04114   Oocyte meiosis hgl04120   Ubiquitin mediated proteolysis hgl04914   Progesterone-mediated oocyte maturation hgl05166   Human T-cell leukemia virus 1 infection Brite KEGG Orthology (KO) [BR:hgl00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     101705159 (Cdc26)  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     101705159 (Cdc26)    04114 Oocyte meiosis     101705159 (Cdc26)  09150 Organismal Systems   09152 Endocrine system    04914 Progesterone-mediated oocyte maturation     101705159 (Cdc26)  09160 Human Diseases   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     101705159 (Cdc26)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:hgl04121]     101705159 (Cdc26)    03036 Chromosome and associated proteins [BR:hgl03036]     101705159 (Cdc26) Ubiquitin system [BR:hgl04121]  Ubiquitin ligases (E3)   Multi subunit type E3    APC/C     Other subunits      101705159 (Cdc26) Chromosome and associated proteins [BR:hgl03036]  Eukaryotic type   Sister chromatid separation proteins    APC/C complex     101705159 (Cdc26) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ANAPC_CDC26 Motif Other DBs NCBI-GeneID:  101705159 NCBI-ProteinID:  XP_004849601 UniProt:  A0AAX6PD96 LinkDB All DBs Position Un AA seq 107 aa AA seqDB search MIYSLRIQLEPEDNSVNCVDLSMLRRKPTRLELKLDDIEEFENIRKDLETRKKQKEDVDV IGGNDGEGAIGLSSDPKSREQMINDRIGYKPQPKPNNRSSQFGSFEF NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atgatttattcacttaggatccagttagaacctgaagataattctgtgaattgtgttgac ctcagtatgctgcgacgaaaaccaacgcgcctggagctgaagcttgatgacattgaagaa tttgagaacattcgaaaggacctagagacccgcaagaaacagaaggaagatgtggatgtt ataggtggcaatgatggagaaggagccattgggctcagtagtgaccccaagagccgggaa caaatgattaatgatcggattggttataaacctcaacccaagccaaacaatcgctcatct cagtttggaagttttgaattttaa

DBGET integrated database retrieval system