Heterocephalus glaber (naked mole-rat): 101705831 Help Entry 101705831         CDS       T02812                                  Name (RefSeq) histone H3.3-like   KO K11253   histone H3 Organism hgl  Heterocephalus glaber (naked mole-rat) Pathway hgl04613   Neutrophil extracellular trap formation hgl05034   Alcoholism hgl05202   Transcriptional misregulation in cancer hgl05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:hgl00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     101705831  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     101705831   09163 Immune disease    05322 Systemic lupus erythematosus     101705831   09165 Substance dependence    05034 Alcoholism     101705831  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:hgl03036]     101705831   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hgl04147]     101705831 Chromosome and associated proteins [BR:hgl03036]  Eukaryotic type   Nucleosome assembly factors    Histones     101705831 Exosome [BR:hgl04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    101705831 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone PAF CENP-T_C Motif Other DBs NCBI-GeneID:  101705831 NCBI-ProteinID:  XP_004839027 UniProt:  A0AAX6NXB7 LinkDB All DBs Position Un AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSVPSTGGVKKPHHYRPGTVALREIRRYQKPTE LLIRKLPFQRLVREVAQDFKTDLRFQSAAIGALQETSEAYLGGLFEDTNLCAILAKRVTI MPKGIQLARRIRGEGA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctcgtacaaagcagactgcccgcaaatccactggtggtaaagcgcccaggaaacaa ctggctacaaaagccgctcgtaagagtgtgccctccactggaggggtgaagaaacctcat cattacaggcctgggactgtggcgctccgtgaaattagacgttatcagaagcccactgaa cttctgattcgcaaactccctttccagcgtctggtgcgagaagttgctcaggacttcaaa acagatctgcgcttccagagtgcagctattggtgctttgcaggagacaagtgaggcctat ctgggtggcctgtttgaagataccaacctgtgtgccatccttgccaaacgtgtaacaatt atgccaaaaggtatccaactagcacgccgcatacgtggagaaggtgcttaa

DBGET integrated database retrieval system