Heterocephalus glaber (naked mole-rat): 101706663 Help Entry 101706663         CDS       T02812                                  Symbol Polr2h Name (RefSeq) RNA polymerase II subunit H   KO K03016   DNA-directed RNA polymerases I, II, and III subunit RPABC3 Organism hgl  Heterocephalus glaber (naked mole-rat) Pathway hgl03020   RNA polymerase hgl03420   Nucleotide excision repair hgl04623   Cytosolic DNA-sensing pathway hgl05016   Huntington disease Brite KEGG Orthology (KO) [BR:hgl00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     101706663 (Polr2h)   09124 Replication and repair    03420 Nucleotide excision repair     101706663 (Polr2h)  09150 Organismal Systems   09151 Immune system    04623 Cytosolic DNA-sensing pathway     101706663 (Polr2h)  09160 Human Diseases   09164 Neurodegenerative disease    05016 Huntington disease     101706663 (Polr2h)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:hgl03021]     101706663 (Polr2h)    03400 DNA repair and recombination proteins [BR:hgl03400]     101706663 (Polr2h) Transcription machinery [BR:hgl03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      101706663 (Polr2h)   RNA polymerase III system    RNA polymerase III      101706663 (Polr2h)   RNA polymerase I system    RNA polymerase I      101706663 (Polr2h) DNA repair and recombination proteins [BR:hgl03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       101706663 (Polr2h) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  RNA_pol_Rpb8 RNA_pol_RpbG Motif Other DBs NCBI-GeneID:  101706663 NCBI-ProteinID:  XP_004834922 UniProt:  A0A0P6JIA5 LinkDB All DBs Position Un AA seq 150 aa AA seqDB search MAGILFEDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILDVNIQIYPVDLGDKFRLVI ASTLYEDGTLDDGEYNPTDDRPSRADQFEYVMYGKVYRIEGDETSTEAATRLSAYVSYGG LLMRLQGDANNLHGFEVDSRVYLLMKKLAF NT seq 453 nt NT seq  +upstreamnt  +downstreamnt atggcgggcatcctgtttgaggatatttttgatgtgaaagacattgacccggaaggcaag aagtttgaccgagtatctcgactgcattgtgagagtgaatctttcaagatggacctcatc ttagatgtgaacattcagatttaccctgtagacttgggtgacaagttccgattggttata gctagtaccttgtatgaagatggtacgcttgatgatggtgaatacaaccccacagatgac aggccttccagggctgaccagtttgagtatgtaatgtatgggaaagtgtacaggattgag ggggatgaaacatctactgaagcagcaacacgcctctctgcctacgtttcctacgggggc ctgctcatgaggctgcagggtgatgccaacaacctgcacggctttgaggtggattccaga gtttatctgctaatgaagaaactggccttctga

DBGET integrated database retrieval system