Heterocephalus glaber (naked mole-rat): 101706975 Help Entry 101706975         CDS       T02812                                  Name (RefSeq) cytochrome c oxidase subunit 6B2   KO K02267   cytochrome c oxidase subunit 6b Organism hgl  Heterocephalus glaber (naked mole-rat) Pathway hgl00190   Oxidative phosphorylation hgl01100   Metabolic pathways hgl04260   Cardiac muscle contraction hgl04714   Thermogenesis hgl04932   Non-alcoholic fatty liver disease hgl05010   Alzheimer disease hgl05012   Parkinson disease hgl05014   Amyotrophic lateral sclerosis hgl05016   Huntington disease hgl05020   Prion disease hgl05022   Pathways of neurodegeneration - multiple diseases hgl05208   Chemical carcinogenesis - reactive oxygen species hgl05415   Diabetic cardiomyopathy Module hgl_M00154   Cytochrome c oxidase Brite KEGG Orthology (KO) [BR:hgl00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     101706975  09150 Organismal Systems   09153 Circulatory system    04260 Cardiac muscle contraction     101706975   09159 Environmental adaptation    04714 Thermogenesis     101706975  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     101706975   09164 Neurodegenerative disease    05010 Alzheimer disease     101706975    05012 Parkinson disease     101706975    05014 Amyotrophic lateral sclerosis     101706975    05016 Huntington disease     101706975    05020 Prion disease     101706975    05022 Pathways of neurodegeneration - multiple diseases     101706975   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     101706975   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     101706975 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  COX6B CX9C Motif Other DBs NCBI-GeneID:  101706975 NCBI-ProteinID:  XP_004866713 UniProt:  G5BVZ6 LinkDB All DBs Position Un AA seq 88 aa AA seqDB search MLGVEAQKSPKGKWTMPPFDPRFPNQNQIHNCYQNFLDYHRCVKAMSRCGQSSQLCEYYF RVYRLLCPLSWVQRWNQQIQDGPFAGKI NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atgttgggtgtcgaagcccagaagtcccccaaggggaaatggaccatgccaccctttgac ccgcgcttccccaaccagaaccagatccataactgctaccagaacttcctggactaccac cgctgcgttaaggcaatgagccgctgcggccagagctcgcagctctgcgagtactatttc cgcgtgtaccgcttgctgtgccccctcagctgggtgcagcgctggaaccagcagatccag gacgggcctttcgcaggcaaaatctga

DBGET integrated database retrieval system