Heterocephalus glaber (naked mole-rat): 101707684 Help Entry 101707684         CDS       T02812                                  Symbol Igf1 Name (RefSeq) insulin like growth factor 1   KO K05459   insulin-like growth factor 1 Organism hgl  Heterocephalus glaber (naked mole-rat) Pathway hgl01521   EGFR tyrosine kinase inhibitor resistance hgl01522   Endocrine resistance hgl04010   MAPK signaling pathway hgl04014   Ras signaling pathway hgl04015   Rap1 signaling pathway hgl04066   HIF-1 signaling pathway hgl04068   FoxO signaling pathway hgl04081   Hormone signaling hgl04114   Oocyte meiosis hgl04115   p53 signaling pathway hgl04150   mTOR signaling pathway hgl04151   PI3K-Akt signaling pathway hgl04152   AMPK signaling pathway hgl04211   Longevity regulating pathway hgl04213   Longevity regulating pathway - multiple species hgl04510   Focal adhesion hgl04550   Signaling pathways regulating pluripotency of stem cells hgl04730   Long-term depression hgl04750   Inflammatory mediator regulation of TRP channels hgl04913   Ovarian steroidogenesis hgl04914   Progesterone-mediated oocyte maturation hgl04935   Growth hormone synthesis, secretion and action hgl04960   Aldosterone-regulated sodium reabsorption hgl05200   Pathways in cancer hgl05202   Transcriptional misregulation in cancer hgl05205   Proteoglycans in cancer hgl05214   Glioma hgl05215   Prostate cancer hgl05218   Melanoma hgl05224   Breast cancer hgl05410   Hypertrophic cardiomyopathy hgl05414   Dilated cardiomyopathy Brite KEGG Orthology (KO) [BR:hgl00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     101707684 (Igf1)    04014 Ras signaling pathway     101707684 (Igf1)    04015 Rap1 signaling pathway     101707684 (Igf1)    04066 HIF-1 signaling pathway     101707684 (Igf1)    04068 FoxO signaling pathway     101707684 (Igf1)    04151 PI3K-Akt signaling pathway     101707684 (Igf1)    04152 AMPK signaling pathway     101707684 (Igf1)    04150 mTOR signaling pathway     101707684 (Igf1)   09133 Signaling molecules and interaction    04081 Hormone signaling     101707684 (Igf1)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     101707684 (Igf1)    04115 p53 signaling pathway     101707684 (Igf1)   09144 Cellular community - eukaryotes    04510 Focal adhesion     101707684 (Igf1)    04550 Signaling pathways regulating pluripotency of stem cells     101707684 (Igf1)  09150 Organismal Systems   09152 Endocrine system    04913 Ovarian steroidogenesis     101707684 (Igf1)    04914 Progesterone-mediated oocyte maturation     101707684 (Igf1)    04935 Growth hormone synthesis, secretion and action     101707684 (Igf1)   09155 Excretory system    04960 Aldosterone-regulated sodium reabsorption     101707684 (Igf1)   09156 Nervous system    04730 Long-term depression     101707684 (Igf1)   09157 Sensory system    04750 Inflammatory mediator regulation of TRP channels     101707684 (Igf1)   09149 Aging    04211 Longevity regulating pathway     101707684 (Igf1)    04213 Longevity regulating pathway - multiple species     101707684 (Igf1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     101707684 (Igf1)    05202 Transcriptional misregulation in cancer     101707684 (Igf1)    05205 Proteoglycans in cancer     101707684 (Igf1)   09162 Cancer: specific types    05214 Glioma     101707684 (Igf1)    05218 Melanoma     101707684 (Igf1)    05215 Prostate cancer     101707684 (Igf1)    05224 Breast cancer     101707684 (Igf1)   09166 Cardiovascular disease    05410 Hypertrophic cardiomyopathy     101707684 (Igf1)    05414 Dilated cardiomyopathy     101707684 (Igf1)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     101707684 (Igf1)    01522 Endocrine resistance     101707684 (Igf1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:hgl04052]     101707684 (Igf1) Cytokines and neuropeptides [BR:hgl04052]  Cytokines   Growth factors (RTK binding)    101707684 (Igf1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Insulin Fijivirus_P9-2 Motif Other DBs NCBI-GeneID:  101707684 NCBI-ProteinID:  XP_004844899 UniProt:  A0A0N8EUV1 LinkDB All DBs Position Un AA seq 153 aa AA seqDB search MGKISSLPTQLFKCCFCDFLKVRMRSVSFSHLFYLALCLLAFTGSATAGPETLCGAELVD ALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPPKSARS VRAQRHTDLPKTPKEVHLKNASRGSAGNRNYRM NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atgggaaaaatcagcagtcttccaactcaattatttaagtgctgcttttgtgatttcttg aaggtcaggatgcgctccgtgtccttttcgcacctcttctacctggccctctgcttgctc gccttcaccggctcggccacagcggggccggagactctctgcggggcggagctggtcgac gcgcttcagttcgtgtgtggagacaggggcttttacttcaacaagcccacggggtacggc tccagcagtcggcgggcgccccagaccggcatcgtggacgagtgctgcttccggagctgc gacctgcggcggctggagatgtactgcgccccgctcaagccccccaagtcagcccgctcc gtgcgcgcccagcgccacaccgacctgcccaagacccccaaggaagtacatttgaagaat gcgagtagggggagtgcaggaaacaggaactacaggatgtag

DBGET integrated database retrieval system