Heterocephalus glaber (naked mole-rat): 101708155 Help Entry 101708155         CDS       T02812                                  Symbol Rpa3 Name (RefSeq) replication protein A3   KO K10740   replication factor A3 Organism hgl  Heterocephalus glaber (naked mole-rat) Pathway hgl03030   DNA replication hgl03420   Nucleotide excision repair hgl03430   Mismatch repair hgl03440   Homologous recombination hgl03460   Fanconi anemia pathway Brite KEGG Orthology (KO) [BR:hgl00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     101708155 (Rpa3)    03420 Nucleotide excision repair     101708155 (Rpa3)    03430 Mismatch repair     101708155 (Rpa3)    03440 Homologous recombination     101708155 (Rpa3)    03460 Fanconi anemia pathway     101708155 (Rpa3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:hgl03032]     101708155 (Rpa3)    03400 DNA repair and recombination proteins [BR:hgl03400]     101708155 (Rpa3) DNA replication proteins [BR:hgl03032]  Eukaryotic type   DNA Replication Elongation Factors    RPA (replication protein A)     101708155 (Rpa3) DNA repair and recombination proteins [BR:hgl03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     RPA (replication factor A)      101708155 (Rpa3)    MMR (mismatch excision repair)      101708155 (Rpa3)   DSBR (double strand breaks repair)    HR (homologous recombination)      101708155 (Rpa3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Rep_fac-A_3 Motif Other DBs NCBI-GeneID:  101708155 NCBI-ProteinID:  XP_004862792 UniProt:  A0A0P6J350 LinkDB All DBs Position Un AA seq 122 aa AA seqDB search MVDVMELPKSRINASMISQFIDRPVCFVGRLEKIHPTGKMFILSDGEGKNGTIELMEPLD EEISGIVEVVGRVTPKATIMCASYIQFREDNSPFDLGLYNEAVKIIHEFPLFFPFGVVQH ES NT seq 369 nt NT seq  +upstreamnt  +downstreamnt atggtggacgtaatggagttgcccaaatcgcgcatcaacgccagcatgatatctcagttc attgaccggccagtctgcttcgtagggaggctggaaaagattcatcccacaggaaaaatg tttatcctttcagatggagaaggaaaaaatggaaccattgaattaatggagccacttgat gaagaaatatctggaatcgtggaagtagttggaagagtaacacccaaggctaccatcatg tgtgcatcttacatccagtttagagaagacaacagtccttttgatcttggactttacaat gaagcagtgaaaattatccatgaattccctctgttttttccttttggagttgtacaacat gaatcttga

DBGET integrated database retrieval system