Heterocephalus glaber (naked mole-rat): 101709292 Help Entry 101709292         CDS       T02812                                  Symbol Gng13 Name (RefSeq) G protein subunit gamma 13   KO K04547   guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-13 Organism hgl  Heterocephalus glaber (naked mole-rat) Pathway hgl04014   Ras signaling pathway hgl04062   Chemokine signaling pathway hgl04081   Hormone signaling hgl04082   Neuroactive ligand signaling hgl04151   PI3K-Akt signaling pathway hgl04371   Apelin signaling pathway hgl04713   Circadian entrainment hgl04723   Retrograde endocannabinoid signaling hgl04724   Glutamatergic synapse hgl04725   Cholinergic synapse hgl04726   Serotonergic synapse hgl04727   GABAergic synapse hgl04728   Dopaminergic synapse hgl04740   Olfactory transduction hgl04742   Taste transduction hgl04926   Relaxin signaling pathway hgl05032   Morphine addiction hgl05034   Alcoholism hgl05163   Human cytomegalovirus infection hgl05167   Kaposi sarcoma-associated herpesvirus infection hgl05170   Human immunodeficiency virus 1 infection hgl05200   Pathways in cancer Brite KEGG Orthology (KO) [BR:hgl00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     101709292 (Gng13)    04371 Apelin signaling pathway     101709292 (Gng13)    04151 PI3K-Akt signaling pathway     101709292 (Gng13)   09133 Signaling molecules and interaction    04082 Neuroactive ligand signaling     101709292 (Gng13)    04081 Hormone signaling     101709292 (Gng13)  09150 Organismal Systems   09151 Immune system    04062 Chemokine signaling pathway     101709292 (Gng13)   09152 Endocrine system    04926 Relaxin signaling pathway     101709292 (Gng13)   09156 Nervous system    04724 Glutamatergic synapse     101709292 (Gng13)    04727 GABAergic synapse     101709292 (Gng13)    04725 Cholinergic synapse     101709292 (Gng13)    04728 Dopaminergic synapse     101709292 (Gng13)    04726 Serotonergic synapse     101709292 (Gng13)    04723 Retrograde endocannabinoid signaling     101709292 (Gng13)   09157 Sensory system    04740 Olfactory transduction     101709292 (Gng13)    04742 Taste transduction     101709292 (Gng13)   09159 Environmental adaptation    04713 Circadian entrainment     101709292 (Gng13)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     101709292 (Gng13)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     101709292 (Gng13)    05163 Human cytomegalovirus infection     101709292 (Gng13)    05167 Kaposi sarcoma-associated herpesvirus infection     101709292 (Gng13)   09165 Substance dependence    05032 Morphine addiction     101709292 (Gng13)    05034 Alcoholism     101709292 (Gng13)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:hgl04031]     101709292 (Gng13) GTP-binding proteins [BR:hgl04031]  Heterotrimeric G-proteins   Gamma Subunits    Gamma [OT]     101709292 (Gng13) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  G-gamma CKAP2_C Motif Other DBs NCBI-GeneID:  101709292 NCBI-ProteinID:  XP_004873894 UniProt:  G5BXU6 LinkDB All DBs Position Un AA seq 67 aa AA seqDB search MEEWDVPQMKKEVESLKYQLAFKREMSSKTIPELLKWIEDGIPKDPFLNPDLMKNNPWVE KGKCAIL NT seq 204 nt NT seq  +upstreamnt  +downstreamnt atggaggagtgggatgtcccccagatgaagaaagaggtagagagcctcaagtaccagctg gccttcaagagggagatgtcctccaagaccatcccagagctcctcaaatggatcgaggat gggatccccaaggaccccttcctgaaccctgacctgatgaagaacaacccctgggtggag aagggcaagtgcgccatcctgtga

DBGET integrated database retrieval system