KEGG   Heterocephalus glaber (naked mole-rat): 101709806
Entry
101709806         CDS       T02812                                 
Symbol
Psmd7
Name
(RefSeq) proteasome 26S subunit, non-ATPase 7
  KO
K03038  26S proteasome regulatory subunit N8
Organism
hgl  Heterocephalus glaber (naked mole-rat)
Pathway
hgl03050  Proteasome
hgl05010  Alzheimer disease
hgl05012  Parkinson disease
hgl05014  Amyotrophic lateral sclerosis
hgl05016  Huntington disease
hgl05017  Spinocerebellar ataxia
hgl05020  Prion disease
hgl05022  Pathways of neurodegeneration - multiple diseases
hgl05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    101709806 (Psmd7)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    101709806 (Psmd7)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101709806 (Psmd7)
   05012 Parkinson disease
    101709806 (Psmd7)
   05014 Amyotrophic lateral sclerosis
    101709806 (Psmd7)
   05016 Huntington disease
    101709806 (Psmd7)
   05017 Spinocerebellar ataxia
    101709806 (Psmd7)
   05020 Prion disease
    101709806 (Psmd7)
   05022 Pathways of neurodegeneration - multiple diseases
    101709806 (Psmd7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:hgl03051]
    101709806 (Psmd7)
Proteasome [BR:hgl03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     101709806 (Psmd7)
SSDB
Motif
Pfam: MitMem_reg JAB Connexin Coilin_N
Other DBs
NCBI-GeneID: 101709806
NCBI-ProteinID: XP_004842988
UniProt: G5AK36
LinkDB
Position
Un
AA seq 324 aa
MPELAVQKVVVHPLVLLSVVDHFNRIGKVGNQKRVVGVLLGSWQKKVLDVSNSFAVPFDE
DDKDDSVWFLDHDYLENMYGMFKKVNARERIVGWYHTGPKLHKNDIAINELMKRYCPNSV
LVIIDVKPKDLGLPTEAYISMEEVHDDGTPTSKTFEHVTSEIGAEEAEEVGVEHLLRDIK
DTTVGTLSQRITNQVHGLKGLNSKLLDIRSYLEKVATGKLPINHQIIYQLQDVFNLLPDV
SLQEFVKAFYLKTNDQMVVVYLASLIRSVVALHNLINNKIANRDAEKKEGQEKEESKKDR
KDDKEKDKDKEKSDVKKEEKKEKK
NT seq 975 nt   +upstreamnt  +downstreamnt
atgccggaactggcggtgcagaaggtggtggtccaccccctggttctgctcagcgtggtc
gatcattttaaccgaatcggcaaggttggaaaccagaagcgcgttgttggtgtgcttttg
ggatcatggcaaaagaaagtacttgatgtatccaacagttttgcagtcccttttgatgaa
gatgacaaagatgactctgtctggtttttagaccatgactatttggaaaacatgtatgga
atgtttaagaaagtcaatgccagagaaagaatagtggggtggtaccacacaggccctaaa
ctacacaagaatgatatcgccatcaatgaactcatgaaaagatactgccctaactcagtg
ttggtcatcattgacgtgaagccaaaggacctggggctgcccacagaagcctacatttcc
atggaggaagttcatgatgatgggactccaacctcaaaaacattcgaacacgtgaccagt
gagattggcgcggaggaggccgaggaagtgggagtggagcacttgttacgggacatcaaa
gacaccaccgtgggcactctgtcccagcggatcactaaccaggtccatggtttgaaggga
ctgaactccaagctgctggatatccggagctacctggaaaaagtagccacaggcaagctg
cccatcaaccaccagatcatctaccagctgcaggacgtctttaacctgctgcccgacgtc
agcctgcaggagttcgtcaaggccttttacctgaagaccaacgatcagatggtggtggtg
tacttggcctctctcatccgctccgtggttgccctgcacaacctcatcaacaacaagatc
gccaaccgggatgcggagaagaaggaagggcaggaaaaagaagagagcaaaaaggataga
aaagatgacaaagagaaagataaagataaggaaaagagtgatgtaaagaaagaagagaaa
aaggagaaaaagtaa

DBGET integrated database retrieval system