Heterocephalus glaber (naked mole-rat): 101710109 Help Entry 101710109         CDS       T02812                                  Symbol Rhoa Name (RefSeq) ras homolog family member A   KO K04513   Ras homolog gene family, member A Organism hgl  Heterocephalus glaber (naked mole-rat) Pathway hgl04014   Ras signaling pathway hgl04015   Rap1 signaling pathway hgl04022   cGMP-PKG signaling pathway hgl04024   cAMP signaling pathway hgl04062   Chemokine signaling pathway hgl04071   Sphingolipid signaling pathway hgl04072   Phospholipase D signaling pathway hgl04081   Hormone signaling hgl04144   Endocytosis hgl04150   mTOR signaling pathway hgl04270   Vascular smooth muscle contraction hgl04310   Wnt signaling pathway hgl04350   TGF-beta signaling pathway hgl04360   Axon guidance hgl04510   Focal adhesion hgl04517   IgSF CAM signaling hgl04519   Cadherin signaling hgl04520   Adherens junction hgl04530   Tight junction hgl04611   Platelet activation hgl04621   NOD-like receptor signaling pathway hgl04625   C-type lectin receptor signaling pathway hgl04660   T cell receptor signaling pathway hgl04670   Leukocyte transendothelial migration hgl04722   Neurotrophin signaling pathway hgl04810   Regulation of actin cytoskeleton hgl04921   Oxytocin signaling pathway hgl04928   Parathyroid hormone synthesis, secretion and action hgl04972   Pancreatic secretion hgl05100   Bacterial invasion of epithelial cells hgl05132   Salmonella infection hgl05133   Pertussis hgl05135   Yersinia infection hgl05152   Tuberculosis hgl05163   Human cytomegalovirus infection hgl05200   Pathways in cancer hgl05203   Viral carcinogenesis hgl05205   Proteoglycans in cancer hgl05206   MicroRNAs in cancer hgl05210   Colorectal cancer hgl05417   Lipid and atherosclerosis hgl05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:hgl00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     101710109 (Rhoa)    04015 Rap1 signaling pathway     101710109 (Rhoa)    04310 Wnt signaling pathway     101710109 (Rhoa)    04350 TGF-beta signaling pathway     101710109 (Rhoa)    04072 Phospholipase D signaling pathway     101710109 (Rhoa)    04071 Sphingolipid signaling pathway     101710109 (Rhoa)    04024 cAMP signaling pathway     101710109 (Rhoa)    04022 cGMP-PKG signaling pathway     101710109 (Rhoa)    04150 mTOR signaling pathway     101710109 (Rhoa)   09133 Signaling molecules and interaction    04081 Hormone signaling     101710109 (Rhoa)    04517 IgSF CAM signaling     101710109 (Rhoa)    04519 Cadherin signaling     101710109 (Rhoa)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     101710109 (Rhoa)   09144 Cellular community - eukaryotes    04510 Focal adhesion     101710109 (Rhoa)    04520 Adherens junction     101710109 (Rhoa)    04530 Tight junction     101710109 (Rhoa)   09142 Cell motility    04810 Regulation of actin cytoskeleton     101710109 (Rhoa)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     101710109 (Rhoa)    04621 NOD-like receptor signaling pathway     101710109 (Rhoa)    04625 C-type lectin receptor signaling pathway     101710109 (Rhoa)    04660 T cell receptor signaling pathway     101710109 (Rhoa)    04670 Leukocyte transendothelial migration     101710109 (Rhoa)    04062 Chemokine signaling pathway     101710109 (Rhoa)   09152 Endocrine system    04921 Oxytocin signaling pathway     101710109 (Rhoa)    04928 Parathyroid hormone synthesis, secretion and action     101710109 (Rhoa)   09153 Circulatory system    04270 Vascular smooth muscle contraction     101710109 (Rhoa)   09154 Digestive system    04972 Pancreatic secretion     101710109 (Rhoa)   09156 Nervous system    04722 Neurotrophin signaling pathway     101710109 (Rhoa)   09158 Development and regeneration    04360 Axon guidance     101710109 (Rhoa)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     101710109 (Rhoa)    05206 MicroRNAs in cancer     101710109 (Rhoa)    05205 Proteoglycans in cancer     101710109 (Rhoa)    05203 Viral carcinogenesis     101710109 (Rhoa)   09162 Cancer: specific types    05210 Colorectal cancer     101710109 (Rhoa)   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     101710109 (Rhoa)   09171 Infectious disease: bacterial    05132 Salmonella infection     101710109 (Rhoa)    05135 Yersinia infection     101710109 (Rhoa)    05133 Pertussis     101710109 (Rhoa)    05152 Tuberculosis     101710109 (Rhoa)    05100 Bacterial invasion of epithelial cells     101710109 (Rhoa)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     101710109 (Rhoa)    05418 Fluid shear stress and atherosclerosis     101710109 (Rhoa)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:hgl04131]     101710109 (Rhoa)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hgl04147]     101710109 (Rhoa)    04031 GTP-binding proteins [BR:hgl04031]     101710109 (Rhoa) Membrane trafficking [BR:hgl04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     101710109 (Rhoa) Exosome [BR:hgl04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    101710109 (Rhoa)   Exosomal proteins of other body fluids (saliva and urine)    101710109 (Rhoa)   Exosomal proteins of colorectal cancer cells    101710109 (Rhoa)   Exosomal proteins of bladder cancer cells    101710109 (Rhoa) GTP-binding proteins [BR:hgl04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     101710109 (Rhoa) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf VASP_tetra Motif Other DBs NCBI-GeneID:  101710109 NCBI-ProteinID:  XP_012925513 UniProt:  G5BZW2 LinkDB All DBs Position Un AA seq 170 aa AA seqDB search VFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMC FSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEE GRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKKSGCLVL NT seq 513 nt NT seq  +upstreamnt  +downstreamnt gtttttagcaaggaccagttcccagaagtatatgtgcccacagtgtttgagaactatgtg gcagatattgaagtggatggaaagcaggtagagttggctttatgggacacagctggacag gaagattatgatcgcctgaggcctctctcctacccagacacggatgttatactgatgtgt ttctccattgacagccctgatagtttagaaaacatcccagaaaaatggaccccagaagta aagcatttctgtcccaatgtacccattatcctggttggaaacaagaaggatcttcggaac gatgagcacacaagacgggagttagccaagatgaagcaggagccagtaaaacctgaagaa ggcagagatatggcaaacaggattggcgcctttgggtacatggaatgttcagcgaagacc aaagatggagtgagggaggtttttgaaatggccacaagagctgctctgcaagccaggcgt gggaagaaaaaatctgggtgccttgtcttgtga

DBGET integrated database retrieval system