Heterocephalus glaber (naked mole-rat): 101711919 Help Entry 101711919         CDS       T02812                                  Symbol Fgf4 Name (RefSeq) fibroblast growth factor 4   KO K04358   fibroblast growth factor Organism hgl  Heterocephalus glaber (naked mole-rat) Pathway hgl04010   MAPK signaling pathway hgl04014   Ras signaling pathway hgl04015   Rap1 signaling pathway hgl04020   Calcium signaling pathway hgl04151   PI3K-Akt signaling pathway hgl04810   Regulation of actin cytoskeleton hgl05200   Pathways in cancer hgl05207   Chemical carcinogenesis - receptor activation hgl05218   Melanoma hgl05224   Breast cancer hgl05226   Gastric cancer Brite KEGG Orthology (KO) [BR:hgl00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     101711919 (Fgf4)    04014 Ras signaling pathway     101711919 (Fgf4)    04015 Rap1 signaling pathway     101711919 (Fgf4)    04020 Calcium signaling pathway     101711919 (Fgf4)    04151 PI3K-Akt signaling pathway     101711919 (Fgf4)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     101711919 (Fgf4)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     101711919 (Fgf4)    05207 Chemical carcinogenesis - receptor activation     101711919 (Fgf4)   09162 Cancer: specific types    05226 Gastric cancer     101711919 (Fgf4)    05218 Melanoma     101711919 (Fgf4)    05224 Breast cancer     101711919 (Fgf4)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:hgl04052]     101711919 (Fgf4)    00536 Glycosaminoglycan binding proteins [BR:hgl00536]     101711919 (Fgf4) Cytokines and neuropeptides [BR:hgl04052]  Cytokines   Growth factors (RTK binding)    101711919 (Fgf4) Glycosaminoglycan binding proteins [BR:hgl00536]  Heparan sulfate / Heparin   Growth factors/receptors    101711919 (Fgf4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  FGF Motif Other DBs NCBI-GeneID:  101711919 NCBI-ProteinID:  XP_004852225 UniProt:  G5BSS2 LinkDB All DBs Position Un AA seq 206 aa AA seqDB search MVGPGTVAVALLPALLLALLGPWSGRGGAAAPTAPNDTLEAELERRWESLVARSLARLPV AAQPKEAAVQSGAGDYLLGIKRLRRLYCNVGIGFHLQVLPDGRIGGVHADTGDSLLELSP VERGVVSIFGVASRFFVAMSSKGKLYGSPFFTKECKFKEILLPNNYNAYESHTYPGMFIA LSKNGRTKKGNRVSPTMKVTHFLPRL NT seq 621 nt NT seq  +upstreamnt  +downstreamnt atggtggggcccgggacggtggctgtggcgctgctcccggcgctcctgctggccctgctg gggccctggtccggccgagggggcgcagccgcgcccaccgcacccaacgacacgctggag gccgagctggagcgccgctgggagagcctggtggcgcgctcgctggcgcgcttgccggtg gccgcgcagcccaaggaggcggccgtccagagcggcgccggcgactacctgctgggcatc aagcggctgcggcgtttgtactgcaacgtgggcatcggcttccacctccaggtgctcccc gacggccgcatcggcggcgtgcacgcggacaccggcgacagccttctggaactctctcca gtggaacgcggggtcgtgagcatctttggagtggccagccgattcttcgtggccatgagc agcaagggcaagctctacggctcgcctttcttcaccaaagagtgcaagttcaaggagatc cttctacccaacaactacaatgcctacgagtcccacacctaccctggcatgtttatcgcc ctgagtaagaatgggaggaccaagaaggggaaccgagtgtcccccaccatgaaggtcacc cactttctccccaggctgtga

DBGET integrated database retrieval system