Heterocephalus glaber (naked mole-rat): 101712384 Help Entry 101712384         CDS       T02812                                  Symbol Ccl5 Name (RefSeq) C-C motif chemokine ligand 5   KO K12499   C-C motif chemokine 5 Organism hgl  Heterocephalus glaber (naked mole-rat) Pathway hgl04060   Cytokine-cytokine receptor interaction hgl04061   Viral protein interaction with cytokine and cytokine receptor hgl04062   Chemokine signaling pathway hgl04620   Toll-like receptor signaling pathway hgl04621   NOD-like receptor signaling pathway hgl04623   Cytosolic DNA-sensing pathway hgl04668   TNF signaling pathway hgl05020   Prion disease hgl05142   Chagas disease hgl05163   Human cytomegalovirus infection hgl05164   Influenza A hgl05168   Herpes simplex virus 1 infection hgl05323   Rheumatoid arthritis hgl05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:hgl00001]  09130 Environmental Information Processing   09132 Signal transduction    04668 TNF signaling pathway     101712384 (Ccl5)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     101712384 (Ccl5)    04061 Viral protein interaction with cytokine and cytokine receptor     101712384 (Ccl5)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     101712384 (Ccl5)    04621 NOD-like receptor signaling pathway     101712384 (Ccl5)    04623 Cytosolic DNA-sensing pathway     101712384 (Ccl5)    04062 Chemokine signaling pathway     101712384 (Ccl5)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     101712384 (Ccl5)    05168 Herpes simplex virus 1 infection     101712384 (Ccl5)    05163 Human cytomegalovirus infection     101712384 (Ccl5)   09174 Infectious disease: parasitic    05142 Chagas disease     101712384 (Ccl5)   09163 Immune disease    05323 Rheumatoid arthritis     101712384 (Ccl5)   09164 Neurodegenerative disease    05020 Prion disease     101712384 (Ccl5)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     101712384 (Ccl5)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:hgl04052]     101712384 (Ccl5)    00536 Glycosaminoglycan binding proteins [BR:hgl00536]     101712384 (Ccl5) Cytokines and neuropeptides [BR:hgl04052]  Cytokines   Chemokines    101712384 (Ccl5) Glycosaminoglycan binding proteins [BR:hgl00536]  Heparan sulfate / Heparin   Chemokines    101712384 (Ccl5) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  101712384 NCBI-ProteinID:  XP_004870720 UniProt:  A0A0P6J714 LinkDB All DBs Position Un AA seq 111 aa AA seqDB search MPAEDPEIASVSATALPASTMKVSAAALSVVLTAAALCATASASPHASDTTPCCFAYMPR PLPRHHITEYFYTSGKCSNSAVVFVTRKNRQVCANPEKKWVREYINALEMN NT seq 336 nt NT seq  +upstreamnt  +downstreamnt atgcctgccgaagatcccgagatagcatctgtgtctgccacagccctgcctgcaagtacc atgaaggtctccgcagctgccctctctgtcgtcctaactgctgccgccctctgtgctact gcatctgcctccccacatgcctcagacaccactccttgctgctttgcctacatgccccgg ccactgccccgccaccacatcacggaatatttctacaccagtggcaagtgctccaactca gctgtcgtatttgttacccgaaagaaccgccaggtgtgtgccaacccagagaagaagtgg gttcgagagtacatcaacgctttagagatgaactag

DBGET integrated database retrieval system