Heterocephalus glaber (naked mole-rat): 101713277 Help Entry 101713277         CDS       T02812                                  Symbol Cldn7, Claudin-7 Name (RefSeq) claudin 7   KO K06087   claudin Organism hgl  Heterocephalus glaber (naked mole-rat) Pathway hgl03272   Virion - Hepatitis viruses hgl04382   Cornified envelope formation hgl04514   Cell adhesion molecules hgl04530   Tight junction hgl04670   Leukocyte transendothelial migration hgl05160   Hepatitis C Brite KEGG Orthology (KO) [BR:hgl00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     101713277 (Cldn7)  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     101713277 (Cldn7)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     101713277 (Cldn7)  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     101713277 (Cldn7)   09158 Development and regeneration    04382 Cornified envelope formation     101713277 (Cldn7)  09160 Human Diseases   09172 Infectious disease: viral    05160 Hepatitis C     101713277 (Cldn7)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:hgl03037]     101713277 (Cldn7)    04147 Exosome [BR:hgl04147]     101713277 (Cldn7)    04515 Cell adhesion molecules [BR:hgl04515]     101713277 (Cldn7) Cilium and associated proteins [BR:hgl03037]  Other cilia and associated proteins   Stereociliary proteins    101713277 (Cldn7) Exosome [BR:hgl04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    101713277 (Cldn7)   Exosomal proteins of colorectal cancer cells    101713277 (Cldn7) Cell adhesion molecules [BR:hgl04515]  Immunoglobulin superfamily   L1 family    101713277 (Cldn7) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PMP22_Claudin Claudin_2 FTR1 Clc-like OppC_N Motif Other DBs NCBI-GeneID:  101713277 NCBI-ProteinID:  XP_004857440 UniProt:  G5B5A8 LinkDB All DBs Position Un AA seq 211 aa AA seqDB search MANSGLQLLGFSLAMLGWVALVVSTAIPQWQVSSYAGDNIITAQAMYKGLWMECVTQSTG LMNCKKYESVLALPATTQATRALMVLSLVLGFLAMFAATVGMKCTRCGGDDKLKKARIAM SGGIVFIVAGLASLIACAWCTHQIVTDFYNPYTPVNAKYEFGSALFIGWAGTALALLGGG LLSCSCPIRESKASYRAPQTYPKSASAKEYV NT seq 636 nt NT seq  +upstreamnt  +downstreamnt atggccaattcgggcctgcagctgctgggcttttccctggcgatgctgggttgggtggcc ctggtggtgagcactgccatcccgcagtggcaggtgagctcgtacgcgggcgacaacatc atcacggcccaggccatgtacaaggggctatggatggagtgcgtcacgcagagcaccggg ttgatgaactgcaaaaagtacgagtcggtgctcgccctgccggcgacaacacaagccact cgagccctaatggtgttgtccttggtcctgggcttcctggccatgtttgcggccaccgtg ggtatgaagtgcacccgctgtgggggagatgacaaattgaagaaggcccgtatagccatg tctggaggcatcgttttcatcgtggcaggtcttgcctccttgatagcatgtgcctggtgt actcatcagattgtcacagacttttataacccttatactcctgtgaatgctaagtacgag tttggatctgctctctttattggctgggcagggactgccctggcattgctgggaggcggg ctgctctcctgctcctgtcctatacgtgagagcaaagcttcctaccgtgctccccagacc taccccaagtccgcctctgccaaggagtatgtgtga

DBGET integrated database retrieval system