Heterocephalus glaber (naked mole-rat): 101713410 Help Entry 101713410         CDS       T02812                                  Symbol Bcl2l1 Name (RefSeq) BCL2 like 1   KO K04570   Bcl-2-like 1 (apoptosis regulator Bcl-X) Organism hgl  Heterocephalus glaber (naked mole-rat) Pathway hgl01521   EGFR tyrosine kinase inhibitor resistance hgl01524   Platinum drug resistance hgl04014   Ras signaling pathway hgl04064   NF-kappa B signaling pathway hgl04115   p53 signaling pathway hgl04137   Mitophagy - animal hgl04140   Autophagy - animal hgl04151   PI3K-Akt signaling pathway hgl04210   Apoptosis hgl04215   Apoptosis - multiple species hgl04621   NOD-like receptor signaling pathway hgl04630   JAK-STAT signaling pathway hgl05012   Parkinson disease hgl05014   Amyotrophic lateral sclerosis hgl05022   Pathways of neurodegeneration - multiple diseases hgl05145   Toxoplasmosis hgl05162   Measles hgl05166   Human T-cell leukemia virus 1 infection hgl05168   Herpes simplex virus 1 infection hgl05170   Human immunodeficiency virus 1 infection hgl05200   Pathways in cancer hgl05202   Transcriptional misregulation in cancer hgl05212   Pancreatic cancer hgl05220   Chronic myeloid leukemia hgl05222   Small cell lung cancer hgl05225   Hepatocellular carcinoma hgl05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:hgl00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     101713410 (Bcl2l1)    04630 JAK-STAT signaling pathway     101713410 (Bcl2l1)    04064 NF-kappa B signaling pathway     101713410 (Bcl2l1)    04151 PI3K-Akt signaling pathway     101713410 (Bcl2l1)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     101713410 (Bcl2l1)    04137 Mitophagy - animal     101713410 (Bcl2l1)   09143 Cell growth and death    04210 Apoptosis     101713410 (Bcl2l1)    04215 Apoptosis - multiple species     101713410 (Bcl2l1)    04115 p53 signaling pathway     101713410 (Bcl2l1)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     101713410 (Bcl2l1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     101713410 (Bcl2l1)    05202 Transcriptional misregulation in cancer     101713410 (Bcl2l1)   09162 Cancer: specific types    05212 Pancreatic cancer     101713410 (Bcl2l1)    05225 Hepatocellular carcinoma     101713410 (Bcl2l1)    05220 Chronic myeloid leukemia     101713410 (Bcl2l1)    05222 Small cell lung cancer     101713410 (Bcl2l1)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     101713410 (Bcl2l1)    05170 Human immunodeficiency virus 1 infection     101713410 (Bcl2l1)    05162 Measles     101713410 (Bcl2l1)    05168 Herpes simplex virus 1 infection     101713410 (Bcl2l1)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     101713410 (Bcl2l1)   09164 Neurodegenerative disease    05012 Parkinson disease     101713410 (Bcl2l1)    05014 Amyotrophic lateral sclerosis     101713410 (Bcl2l1)    05022 Pathways of neurodegeneration - multiple diseases     101713410 (Bcl2l1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     101713410 (Bcl2l1)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     101713410 (Bcl2l1)    01524 Platinum drug resistance     101713410 (Bcl2l1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:hgl01009]     101713410 (Bcl2l1)   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:hgl03036]     101713410 (Bcl2l1)   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:hgl02000]     101713410 (Bcl2l1) Protein phosphatases and associated proteins [BR:hgl01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      101713410 (Bcl2l1) Chromosome and associated proteins [BR:hgl03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     101713410 (Bcl2l1) Transporters [BR:hgl02000]  Other transporters   Pores ion channels [TC:1]    101713410 (Bcl2l1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 Motif Other DBs NCBI-GeneID:  101713410 NCBI-ProteinID:  XP_004840656 UniProt:  G5BQH7 LinkDB All DBs Position Un AA seq 233 aa AA seqDB search MSQSNWELVVDFLSYKLSQKGYSWSQFSDVEESRTEAPEGTESEMETPSAISGNPSWHLA DSPTVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVRRIASWMATYLNDHLEP WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGMVLLGSLFSRK NT seq 702 nt NT seq  +upstreamnt  +downstreamnt atgtctcagagcaactgggagctggtggttgactttctctcctacaagctttcccagaaa ggatacagctggagtcagttcagtgatgtggaagagagcaggactgaagccccagaaggg actgaatcagagatggagacccccagtgccatcagtggcaacccatcctggcacctggcg gatagccccacggtgaacggggcaactggccacagcagcagtttggatgcccgggaggtg atccccatggcagcagtgaagcaggctctgagggaagcaggtgacgagtttgaacttcgg taccggcgggcattcagtgacctaacatctcagctccacatcaccccagggacagcatat cagagctttgaacaggtagtgaatgaactcttccgggatggggtaaactggggtcgcatt gtggcctttttctccttcggcggggcattgtgcgtggagagcgtagacaaggagatgcag gtattggtgaggcggatcgcaagctggatggccacttacctgaatgaccacctagagcct tggatccaggagaacggaggctgggacacttttgtggaactctacgggaacaatgcagca gccgagagccggaagggccaggaacgcttcaaccgctggttcctgacgggcatgactgtg gctggcatggttctgctgggctcactcttcagtcggaaatga

DBGET integrated database retrieval system