Heterocephalus glaber (naked mole-rat): 101713689 Help Entry 101713689         CDS       T02812                                  Name (RefSeq) histone H4   KO K11254   histone H4 Organism hgl  Heterocephalus glaber (naked mole-rat) Pathway hgl04613   Neutrophil extracellular trap formation hgl05034   Alcoholism hgl05203   Viral carcinogenesis hgl05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:hgl00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     101713689  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     101713689   09163 Immune disease    05322 Systemic lupus erythematosus     101713689   09165 Substance dependence    05034 Alcoholism     101713689  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:hgl03036]     101713689 Chromosome and associated proteins [BR:hgl03036]  Eukaryotic type   Nucleosome assembly factors    Histones     101713689 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CENP-T_C TAF Histone CENP-S CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137 Motif Other DBs NCBI-GeneID:  101713689 NCBI-ProteinID:  XP_004847877 UniProt:  G5BKL3 LinkDB All DBs Position Un AA seq 103 aa AA seqDB search MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgtcaggacgtggcaagggcgggaagggcctgggcaagggcggtgccaagcgccaccgc aaggtgctgcgcgacaacatccagggcatcaccaaacctgccatccgccgcctagcccgg cgcggcggcgtcaagcgcatttccggtctcatctacgaggagacgcgtggggtgctgaag gtcttcctggagaacgtgatccgcgacgccgtcacctacacagagcacgccaagcggaag acggtcacggccatggacgtggtctacgcgctcaagcgccagggccgcacgctctacggc ttcggcggctga

DBGET integrated database retrieval system