Heterocephalus glaber (naked mole-rat): 101713909 Help Entry 101713909         CDS       T02812                                  Symbol Myl2 Name (RefSeq) myosin light chain 2   KO K10351   myosin regulatory light chain 2 Organism hgl  Heterocephalus glaber (naked mole-rat) Pathway hgl04260   Cardiac muscle contraction hgl04261   Adrenergic signaling in cardiomyocytes hgl04371   Apelin signaling pathway hgl04510   Focal adhesion hgl04520   Adherens junction hgl04530   Tight junction hgl04670   Leukocyte transendothelial migration hgl04810   Regulation of actin cytoskeleton hgl04814   Motor proteins hgl04820   Cytoskeleton in muscle cells hgl05132   Salmonella infection hgl05410   Hypertrophic cardiomyopathy hgl05414   Dilated cardiomyopathy Brite KEGG Orthology (KO) [BR:hgl00001]  09130 Environmental Information Processing   09132 Signal transduction    04371 Apelin signaling pathway     101713909 (Myl2)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     101713909 (Myl2)    04520 Adherens junction     101713909 (Myl2)    04530 Tight junction     101713909 (Myl2)   09142 Cell motility    04814 Motor proteins     101713909 (Myl2)    04820 Cytoskeleton in muscle cells     101713909 (Myl2)    04810 Regulation of actin cytoskeleton     101713909 (Myl2)  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     101713909 (Myl2)   09153 Circulatory system    04260 Cardiac muscle contraction     101713909 (Myl2)    04261 Adrenergic signaling in cardiomyocytes     101713909 (Myl2)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     101713909 (Myl2)   09166 Cardiovascular disease    05410 Hypertrophic cardiomyopathy     101713909 (Myl2)    05414 Dilated cardiomyopathy     101713909 (Myl2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:hgl04812]     101713909 (Myl2) Cytoskeleton proteins [BR:hgl04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Myosins      101713909 (Myl2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_5 EFhand_Ca_insen EF_EFCAB10_C AIF-1 Motif Other DBs NCBI-GeneID:  101713909 NCBI-ProteinID:  XP_004843864 UniProt:  G5AKU1 LinkDB All DBs Position Un AA seq 166 aa AA seqDB search MAPKKAKKRAEGANSNVFSMFEQTQIQEFKEAFTIMDQNRDGFIDKNDLRDTFAALGRVN VKNEEIDEMLKEAPGPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGVLKADYVR EMLTTQAERFSKEEMDQMFAAFPPDVTGNLDYRNLVHIITHGEEKD NT seq 501 nt NT seq  +upstreamnt  +downstreamnt atggcccccaagaaagccaagaagagggcggagggggccaactccaacgtgttctccatg ttcgagcagacccagatccaggagttcaaggaggccttcaccatcatggaccagaaccgt gatggcttcattgacaagaatgacctgagggacacgtttgctgctctggggcgtgtgaat gtgaagaatgaagaaattgatgaaatgctcaaggaggctcctgggccaattaacttcact gtgttcctgaccatgtttggggagaagctgaagggcgcggaccccgaggagaccatcctc aacgcgttcaaggtgttcgaccccgaaggcaaaggcgtgctgaaggctgactacgtccgg gagatgctgaccacgcaggcagagaggttctccaaggaggagatggaccagatgttcgcg gccttcccgccggacgtgaccggcaacctggactaccggaacctggtgcacatcatcacc cacggcgaggagaaggactga

DBGET integrated database retrieval system