Heterocephalus glaber (naked mole-rat): 101714634 Help Entry 101714634         CDS       T02812                                  Symbol Ccl3 Name (RefSeq) C-C motif chemokine ligand 3   KO K05408   C-C motif chemokine 3 Organism hgl  Heterocephalus glaber (naked mole-rat) Pathway hgl04060   Cytokine-cytokine receptor interaction hgl04061   Viral protein interaction with cytokine and cytokine receptor hgl04062   Chemokine signaling pathway hgl04620   Toll-like receptor signaling pathway hgl05142   Chagas disease hgl05163   Human cytomegalovirus infection hgl05323   Rheumatoid arthritis hgl05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:hgl00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     101714634 (Ccl3)    04061 Viral protein interaction with cytokine and cytokine receptor     101714634 (Ccl3)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     101714634 (Ccl3)    04062 Chemokine signaling pathway     101714634 (Ccl3)  09160 Human Diseases   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     101714634 (Ccl3)   09174 Infectious disease: parasitic    05142 Chagas disease     101714634 (Ccl3)   09163 Immune disease    05323 Rheumatoid arthritis     101714634 (Ccl3)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     101714634 (Ccl3)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:hgl04052]     101714634 (Ccl3)    00536 Glycosaminoglycan binding proteins [BR:hgl00536]     101714634 (Ccl3) Cytokines and neuropeptides [BR:hgl04052]  Cytokines   Chemokines    101714634 (Ccl3) Glycosaminoglycan binding proteins [BR:hgl00536]  Heparan sulfate / Heparin   Chemokines    101714634 (Ccl3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  101714634 NCBI-ProteinID:  XP_004870727 UniProt:  G5B737 LinkDB All DBs Position Un AA seq 90 aa AA seqDB search MKPLMTALLVLFCTTMLCSCEEDKRHTAPDCCFSFISRQIPHNLVVAYFKTSGTCLTDGI IFLTKKGLYICADSSNDWVQEYIRDLEANS NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaagcccctcatgactgccctcttggtcctcttctgcacaacaatgctctgctcctgt gaagaagataagcgtcacaccgcacctgactgctgcttctccttcatctcccgtcagatc ccccacaatcttgtggtagcctattttaagaccagtggcacatgccttacagatggtatc atctttctcaccaaaaaaggcctgtatatctgtgccgattccagcaatgactgggtccag gaatacatcagggacctggaggcaaattcttga

DBGET integrated database retrieval system