Heterocephalus glaber (naked mole-rat): 101714714 Help Entry 101714714         CDS       T02812                                  Symbol Ccl25 Name (RefSeq) C-C motif chemokine ligand 25   KO K13072   C-C motif chemokine 25 Organism hgl  Heterocephalus glaber (naked mole-rat) Pathway hgl04060   Cytokine-cytokine receptor interaction hgl04061   Viral protein interaction with cytokine and cytokine receptor hgl04062   Chemokine signaling pathway hgl04672   Intestinal immune network for IgA production Brite KEGG Orthology (KO) [BR:hgl00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     101714714 (Ccl25)    04061 Viral protein interaction with cytokine and cytokine receptor     101714714 (Ccl25)  09150 Organismal Systems   09151 Immune system    04672 Intestinal immune network for IgA production     101714714 (Ccl25)    04062 Chemokine signaling pathway     101714714 (Ccl25)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:hgl04052]     101714714 (Ccl25) Cytokines and neuropeptides [BR:hgl04052]  Cytokines   Chemokines    101714714 (Ccl25) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  101714714 NCBI-ProteinID:  XP_004865450 UniProt:  A0AAX6Q1J8 LinkDB All DBs Position Un AA seq 92 aa AA seqDB search MNPWLLTCLVASFVGAWVPAVHTQGVVEDCCLAYHPHLRLPVLLRTRNFWWQEVSGSCNL PAVIFYFPQLGRTVCGNPQDRVVRKAMKILSA NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgaacccgtggctcctcacctgcctggtggcttccttcgtgggagcctgggtccctgct gtccacacccaaggtgtggtggaggactgctgcctggcctaccacccccacctcaggttg cctgtgctcctgcgcaccaggaatttctggtggcaggaggtgagcggaagttgcaatctg ccagctgtgatattctatttcccccagctaggcaggacagtgtgtgggaaccctcaggac agggtggtgaggaaggccatgaagatcttgagtgct

DBGET integrated database retrieval system