Heterocephalus glaber (naked mole-rat): 101714972 Help Entry 101714972         CDS       T02812                                  Name (RefSeq) histone H2B type 1-N-like   KO K11252   histone H2B Organism hgl  Heterocephalus glaber (naked mole-rat) Pathway hgl04613   Neutrophil extracellular trap formation hgl05034   Alcoholism hgl05203   Viral carcinogenesis hgl05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:hgl00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     101714972  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     101714972   09163 Immune disease    05322 Systemic lupus erythematosus     101714972   09165 Substance dependence    05034 Alcoholism     101714972  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:hgl03036]     101714972   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hgl04147]     101714972 Chromosome and associated proteins [BR:hgl03036]  Eukaryotic type   Nucleosome assembly factors    Histones     101714972 Exosome [BR:hgl04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    101714972 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa ARM_TT21 Motif Other DBs NCBI-GeneID:  101714972 NCBI-ProteinID:  XP_004847881 UniProt:  G5BSG5 A0AAX6PB97 LinkDB All DBs Position Un AA seq 126 aa AA seqDB search MPEPSKSAPAAKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT KYTSAK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgccggaaccctcgaagtcggcgccggccgcgaagaaggggtcgaagaaggcggtgacc aaggcgcagaagaaggacggcaagaagcgcaagcgcagccgcaaggagagctactcggtg tacgtgtataaggtgctgaagcaggtgcacccggacacgggcatctcgtccaaggccatg ggcatcatgaactcgttcgtgaacgacatcttcgagcgcatcgcgggcgaggcgtcgcgc ctggcgcactacaacaagcgctcgaccatcacgtcgcgggagatccagacggccgtgcgg ctgctgctgcctggcgagctggcgaagcacgccgtgtcggagggcaccaaggccgtcacc aagtacaccagcgccaagtga

DBGET integrated database retrieval system