Heterocephalus glaber (naked mole-rat): 101715420 Help Entry 101715420         CDS       T02812                                  Symbol Gnaq Name (RefSeq) G protein subunit alpha q   KO K04634   guanine nucleotide-binding protein G(q) subunit alpha Organism hgl  Heterocephalus glaber (naked mole-rat) Pathway hgl04015   Rap1 signaling pathway hgl04020   Calcium signaling pathway hgl04022   cGMP-PKG signaling pathway hgl04062   Chemokine signaling pathway hgl04071   Sphingolipid signaling pathway hgl04081   Hormone signaling hgl04082   Neuroactive ligand signaling hgl04261   Adrenergic signaling in cardiomyocytes hgl04270   Vascular smooth muscle contraction hgl04371   Apelin signaling pathway hgl04540   Gap junction hgl04611   Platelet activation hgl04713   Circadian entrainment hgl04720   Long-term potentiation hgl04723   Retrograde endocannabinoid signaling hgl04724   Glutamatergic synapse hgl04725   Cholinergic synapse hgl04726   Serotonergic synapse hgl04728   Dopaminergic synapse hgl04730   Long-term depression hgl04750   Inflammatory mediator regulation of TRP channels hgl04911   Insulin secretion hgl04912   GnRH signaling pathway hgl04915   Estrogen signaling pathway hgl04916   Melanogenesis hgl04918   Thyroid hormone synthesis hgl04921   Oxytocin signaling pathway hgl04922   Glucagon signaling pathway hgl04924   Renin secretion hgl04925   Aldosterone synthesis and secretion hgl04927   Cortisol synthesis and secretion hgl04928   Parathyroid hormone synthesis, secretion and action hgl04929   GnRH secretion hgl04934   Cushing syndrome hgl04935   Growth hormone synthesis, secretion and action hgl04961   Endocrine and other factor-regulated calcium reabsorption hgl04970   Salivary secretion hgl04971   Gastric acid secretion hgl04972   Pancreatic secretion hgl05010   Alzheimer disease hgl05016   Huntington disease hgl05017   Spinocerebellar ataxia hgl05022   Pathways of neurodegeneration - multiple diseases hgl05135   Yersinia infection hgl05142   Chagas disease hgl05143   African trypanosomiasis hgl05146   Amoebiasis hgl05163   Human cytomegalovirus infection hgl05170   Human immunodeficiency virus 1 infection hgl05200   Pathways in cancer Brite KEGG Orthology (KO) [BR:hgl00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     101715420 (Gnaq)    04371 Apelin signaling pathway     101715420 (Gnaq)    04020 Calcium signaling pathway     101715420 (Gnaq)    04071 Sphingolipid signaling pathway     101715420 (Gnaq)    04022 cGMP-PKG signaling pathway     101715420 (Gnaq)   09133 Signaling molecules and interaction    04082 Neuroactive ligand signaling     101715420 (Gnaq)    04081 Hormone signaling     101715420 (Gnaq)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04540 Gap junction     101715420 (Gnaq)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     101715420 (Gnaq)    04062 Chemokine signaling pathway     101715420 (Gnaq)   09152 Endocrine system    04911 Insulin secretion     101715420 (Gnaq)    04922 Glucagon signaling pathway     101715420 (Gnaq)    04929 GnRH secretion     101715420 (Gnaq)    04912 GnRH signaling pathway     101715420 (Gnaq)    04915 Estrogen signaling pathway     101715420 (Gnaq)    04921 Oxytocin signaling pathway     101715420 (Gnaq)    04935 Growth hormone synthesis, secretion and action     101715420 (Gnaq)    04918 Thyroid hormone synthesis     101715420 (Gnaq)    04928 Parathyroid hormone synthesis, secretion and action     101715420 (Gnaq)    04916 Melanogenesis     101715420 (Gnaq)    04924 Renin secretion     101715420 (Gnaq)    04925 Aldosterone synthesis and secretion     101715420 (Gnaq)    04927 Cortisol synthesis and secretion     101715420 (Gnaq)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     101715420 (Gnaq)    04270 Vascular smooth muscle contraction     101715420 (Gnaq)   09154 Digestive system    04970 Salivary secretion     101715420 (Gnaq)    04971 Gastric acid secretion     101715420 (Gnaq)    04972 Pancreatic secretion     101715420 (Gnaq)   09155 Excretory system    04961 Endocrine and other factor-regulated calcium reabsorption     101715420 (Gnaq)   09156 Nervous system    04724 Glutamatergic synapse     101715420 (Gnaq)    04725 Cholinergic synapse     101715420 (Gnaq)    04728 Dopaminergic synapse     101715420 (Gnaq)    04726 Serotonergic synapse     101715420 (Gnaq)    04720 Long-term potentiation     101715420 (Gnaq)    04730 Long-term depression     101715420 (Gnaq)    04723 Retrograde endocannabinoid signaling     101715420 (Gnaq)   09157 Sensory system    04750 Inflammatory mediator regulation of TRP channels     101715420 (Gnaq)   09159 Environmental adaptation    04713 Circadian entrainment     101715420 (Gnaq)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     101715420 (Gnaq)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     101715420 (Gnaq)    05163 Human cytomegalovirus infection     101715420 (Gnaq)   09171 Infectious disease: bacterial    05135 Yersinia infection     101715420 (Gnaq)   09174 Infectious disease: parasitic    05146 Amoebiasis     101715420 (Gnaq)    05142 Chagas disease     101715420 (Gnaq)    05143 African trypanosomiasis     101715420 (Gnaq)   09164 Neurodegenerative disease    05010 Alzheimer disease     101715420 (Gnaq)    05016 Huntington disease     101715420 (Gnaq)    05017 Spinocerebellar ataxia     101715420 (Gnaq)    05022 Pathways of neurodegeneration - multiple diseases     101715420 (Gnaq)   09167 Endocrine and metabolic disease    04934 Cushing syndrome     101715420 (Gnaq)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hgl04147]     101715420 (Gnaq)    04031 GTP-binding proteins [BR:hgl04031]     101715420 (Gnaq) Exosome [BR:hgl04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    101715420 (Gnaq) GTP-binding proteins [BR:hgl04031]  Heterotrimeric G-proteins   Alpha Subunits    Alpha type 3 (Gq/11) [OT]     101715420 (Gnaq) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  G-alpha Arf Gtr1_RagA TniB AAA_29 Motif Other DBs NCBI-GeneID:  101715420 NCBI-ProteinID:  XP_004862597 UniProt:  A0A0P6K1M4 LinkDB All DBs Position Un AA seq 359 aa AA seqDB search MTLESIMACCLSEEAKEARRINDEIERQLRRDKRDARRELKLLLLGTGESGKSTFIKQMR IIHGSGYSDEDKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKYEHNKAHAQLVREVDVEK VSAFENPYVDAIKSLWNDPGIQECYDRRREYQLSDSTKYYLNDLDRVADPSYLPTQQDVL RVRVPTTGIIEYPFDLQSVIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLV ESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYSHLVDYFPEYDGPQR DAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYNLV NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt atgactctggagtccatcatggcgtgctgcctgagcgaggaggccaaggaggcccggagg atcaacgacgagatcgagcggcagctccgcagggacaagcgggacgcgcgccgggagctc aagctgctgctgctcgggacaggagagagtggcaagagtacatttatcaagcagatgaga atcatccatgggtcagggtattctgatgaagacaagaggggcttcactaaactggtgtat cagaacatcttcacagccatgcaggccatgatcagagctatggacaccctcaagatcccg tacaagtatgagcataataaggctcatgcacaattagttcgagaagttgatgtggagaag gtgtctgcttttgaaaatccatatgtagatgcaataaagagtttgtggaacgatcctgga atccaggaatgctatgatagacgacgagaatatcagttatctgactctaccaaatactat ctgaatgacttggaccgcgtagctgacccttcctacctgcctacgcaacaagatgtgctt agagttcgagtccccacaacaggaatcattgaatacccttttgacttacaaagtgtcatt ttcagaatggtcgatgtaggaggccaacgatcagagagaagaaaatggatacactgcttt gaaaatgtcacttcaatcatgtttctagtagcacttagtgaatatgatcaagttctcgtg gagtcagacaatgagaaccgaatggaggaaagcaaagcactctttagaacgattatcaca tatccctggttccagaactcctcagtcattctgttcttaaacaagaaggatcttctagag gagaaaattatgtattcccacctagttgactacttcccagaatatgacggaccccagaga gatgcccaggcagctcgagaattcatcctgaagatgttcgtggacctgaacccagacagt gacaaaattatctactcccacttcacgtgcgccacagacaccgagaacatccgctttgtc tttgctgctgtcaaggacaccatcctccagttgaacctgaaggagtacaatctggtctaa

DBGET integrated database retrieval system