Heterocephalus glaber (naked mole-rat): 101715777 Help Entry 101715777         CDS       T02812                                  Symbol Elob, Tceb2 Name (RefSeq) elongin B   KO K03873   elongin-B Organism hgl  Heterocephalus glaber (naked mole-rat) Pathway hgl04066   HIF-1 signaling pathway hgl04120   Ubiquitin mediated proteolysis hgl05170   Human immunodeficiency virus 1 infection hgl05200   Pathways in cancer hgl05211   Renal cell carcinoma Brite KEGG Orthology (KO) [BR:hgl00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     101715777 (Elob)  09130 Environmental Information Processing   09132 Signal transduction    04066 HIF-1 signaling pathway     101715777 (Elob)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     101715777 (Elob)   09162 Cancer: specific types    05211 Renal cell carcinoma     101715777 (Elob)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     101715777 (Elob)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:hgl04121]     101715777 (Elob)    03400 DNA repair and recombination proteins [BR:hgl03400]     101715777 (Elob) Ubiquitin system [BR:hgl04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      101715777 (Elob)    Cul5 complex      101715777 (Elob) DNA repair and recombination proteins [BR:hgl03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      101715777 (Elob) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  101715777 NCBI-ProteinID:  XP_004864733 UniProt:  A0AAX6Q0E5 LinkDB All DBs Position Un AA seq 197 aa AA seqDB search MGVVVFATLKMAPIWLTPRHPRAEMAVIFCAGRAPSGPLKMAAAEGAGLRAEPVGSRAVC WEGVERGRAGASELEAATEMDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDE QRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALRIEPFSSPPELPD VMKPQDSGGSTNEQAVQ NT seq 594 nt NT seq  +upstreamnt  +downstreamnt atgggggtcgttgtcttcgccactctcaaaatggcgccaatttggctcacgccccgacac ccgcgcgccgagatggcggtcatattttgtgcggggcgagccccttccggaccacttaaa atggcggcagccgagggggcggggctgcgcgcggagcctgtcgggtcgcgcgcggtgtgc tgggaaggggtggagcgcggccgcgccggcgcgtcggagctagaggcagccaccgagatg gatgtgttcctcatgatccggcgccacaagaccaccatcttcacggacgccaaggagtcg agcaccgtgttcgagctgaagcgcatcgtcgagggcatcctcaagcggccaccagacgag cagagactgtataaggatgaccagcttctagatgatggcaaaacactgggcgagtgtggc tttaccagccagacagcaaggccacaggccccagccacagtggggctggccttccgggca gatgacacctttgaggccctgcgcatcgagcccttctctagcccaccggagcttccagat gtgatgaagcctcaggactctggagggagcaccaacgaacaagctgtacagtga

DBGET integrated database retrieval system