Heterocephalus glaber (naked mole-rat): 101716095 Help Entry 101716095         CDS       T02812                                  Symbol Dynll2 Name (RefSeq) dynein light chain LC8-type 2   KO K10418   dynein light chain LC8-type Organism hgl  Heterocephalus glaber (naked mole-rat) Pathway hgl04814   Motor proteins hgl04962   Vasopressin-regulated water reabsorption hgl05132   Salmonella infection Brite KEGG Orthology (KO) [BR:hgl00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     101716095 (Dynll2)  09150 Organismal Systems   09155 Excretory system    04962 Vasopressin-regulated water reabsorption     101716095 (Dynll2)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     101716095 (Dynll2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:hgl03037]     101716095 (Dynll2)    04812 Cytoskeleton proteins [BR:hgl04812]     101716095 (Dynll2) Cilium and associated proteins [BR:hgl03037]  Motile cilia and associated proteins   Dynein arm    101716095 (Dynll2) Cytoskeleton proteins [BR:hgl04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      101716095 (Dynll2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light Nop Ectatomin Motif Other DBs NCBI-GeneID:  101716095 NCBI-ProteinID:  XP_004859872 UniProt:  G5C420 LinkDB All DBs Position Un AA seq 89 aa AA seqDB search MSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGR NFGSYVTHETKHFIYFYLGQVAILLFKSG NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgtctgaccggaaggcagtgatcaagaacgcagacatgtctgaggacatgcaacaggat gctgttgactgcgccacgcaggctatggagaaatacaatatagagaaggacattgctgcc tatatcaagaaggaatttgacaagaaatataatcctacctggcattgtatcgtgggccga aattttggcagctacgtcacacacgagacaaagcacttcatctatttttacttgggtcaa gttgcaatcctcctcttcaagtcaggctag

DBGET integrated database retrieval system