Heterocephalus glaber (naked mole-rat): 101716095 Help Entry 101716095         CDS       T02812                                  Symbol Dynll2 Name (RefSeq) dynein light chain LC8-type 2   KO K10418   dynein light chain LC8-type Organism hgl  Heterocephalus glaber (naked mole-rat) Pathway hgl04145   Phagocytosis hgl04517   IgSF CAM signaling hgl04814   Motor proteins hgl04962   Vasopressin-regulated water reabsorption hgl05132   Salmonella infection Brite KEGG Orthology (KO) [BR:hgl00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     101716095 (Dynll2)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     101716095 (Dynll2)   09142 Cell motility    04814 Motor proteins     101716095 (Dynll2)  09150 Organismal Systems   09155 Excretory system    04962 Vasopressin-regulated water reabsorption     101716095 (Dynll2)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     101716095 (Dynll2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:hgl03037]     101716095 (Dynll2)    04812 Cytoskeleton proteins [BR:hgl04812]     101716095 (Dynll2) Cilium and associated proteins [BR:hgl03037]  Motile cilia and associated proteins   Dynein arm    101716095 (Dynll2) Cytoskeleton proteins [BR:hgl04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      101716095 (Dynll2) SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light Nop SpoIIIAH Ectatomin Motif Other DBs NCBI-GeneID:  101716095 NCBI-ProteinID:  XP_004859872 UniProt:  G5C420 LinkDB All DBs Position Un AA seq 89 aa AA seqDB search MSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGR NFGSYVTHETKHFIYFYLGQVAILLFKSG NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgtctgaccggaaggcagtgatcaagaacgcagacatgtctgaggacatgcaacaggat gctgttgactgcgccacgcaggctatggagaaatacaatatagagaaggacattgctgcc tatatcaagaaggaatttgacaagaaatataatcctacctggcattgtatcgtgggccga aattttggcagctacgtcacacacgagacaaagcacttcatctatttttacttgggtcaa gttgcaatcctcctcttcaagtcaggctag

DBGET integrated database retrieval system