Heterocephalus glaber (naked mole-rat): 101716414 Help Entry 101716414         CDS       T02812                                  Symbol Arf1 Name (RefSeq) ADP ribosylation factor 1   KO K07937   ADP-ribosylation factor 1/2 Organism hgl  Heterocephalus glaber (naked mole-rat) Pathway hgl04072   Phospholipase D signaling pathway hgl04144   Endocytosis hgl05132   Salmonella infection hgl05134   Legionellosis Brite KEGG Orthology (KO) [BR:hgl00001]  09130 Environmental Information Processing   09132 Signal transduction    04072 Phospholipase D signaling pathway     101716414 (Arf1)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     101716414 (Arf1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     101716414 (Arf1)    05134 Legionellosis     101716414 (Arf1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:hgl04131]     101716414 (Arf1)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hgl04147]     101716414 (Arf1)    04031 GTP-binding proteins [BR:hgl04031]     101716414 (Arf1) Membrane trafficking [BR:hgl04131]  Endocytosis   Lipid raft mediated endocytosis    GRAF1-dependent endocytosis     101716414 (Arf1)   Arf GTPases and associated proteins    Arf GTPases     101716414 (Arf1)  Endosome - Golgi transport     101716414 (Arf1) Exosome [BR:hgl04147]  Exosomal proteins   Proteins found in most exosomes    101716414 (Arf1) GTP-binding proteins [BR:hgl04031]  Small (monomeric) G-proteins   Arf/Sar Family    Arf [OT]     101716414 (Arf1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Arf Roc SRPRB Ras G-alpha Gtr1_RagA MMR_HSR1 GTP_EFTU 6PF2K FLAD1_M Motif Other DBs NCBI-GeneID:  101716414 NCBI-ProteinID:  XP_004874772 UniProt:  A0AAX6QJ36 A0AAX6SIM3 LinkDB All DBs Position Un AA seq 181 aa AA seqDB search MGNIFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAV LLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLQNQ K NT seq 546 nt NT seq  +upstreamnt  +downstreamnt atggggaatatctttgcgaacctcttcaagggcctctttggcaaaaaagaaatgcgaatt ctcatggtgggcctggatgctgccgggaagacgacgattctttataaactaaagctcggt gaaattgtgaccaccattcctaccataggtttcaatgttgagaccgtcgaatacaagaat atcagctttaccgtgtgggatgtgggtggccaggacaagatccggcctctgtggcgccac tacttccagaacacccaaggcttgatctttgtggtggacagcaatgacagagagcgtgtg aacgaggcccgtgaggagctcatgaggatgttggctgaggatgagctccgggatgctgtc ctcctcgtgtttgccaacaagcaggacctccccaacgcgatgaacgcagctgaaatcaca gacaagctggggctgcactctctacgccacaggaactggtacattcaggccacctgtgcc accagtggggatgggctctatgaaggactggactggctgtccaatcagctccagaaccag aagtga

DBGET integrated database retrieval system