Heterocephalus glaber (naked mole-rat): 101717182 Help Entry 101717182         CDS       T02812                                  Symbol Txn Name (RefSeq) thioredoxin   KO K03671   thioredoxin Organism hgl  Heterocephalus glaber (naked mole-rat) Pathway hgl04621   NOD-like receptor signaling pathway hgl05012   Parkinson disease hgl05132   Salmonella infection hgl05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:hgl00001]  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     101717182 (Txn)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     101717182 (Txn)   09164 Neurodegenerative disease    05012 Parkinson disease     101717182 (Txn)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     101717182 (Txn)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:hgl03110]     101717182 (Txn) Chaperones and folding catalysts [BR:hgl03110]  Protein folding catalysts   Protein disulfide isomerase    101717182 (Txn) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Thioredoxin Thioredoxin_8 DIM1 Thioredoxin_2 OST3_OST6 Thioredoxin_7 Thioredoxin_9 AhpC-TSA Glutaredoxin Redoxin Motif Other DBs NCBI-GeneID:  101717182 NCBI-ProteinID:  XP_004848195 UniProt:  A0A0P6JT29 LinkDB All DBs Position Un AA seq 105 aa AA seqDB search MVQQIDSKEAFQQALAAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVLFLEVDVD DCQDIAAECEVKCMPTFQFFKKGEKVGEFSGANKEKLEATITELV NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atggtgcagcagatcgatagcaaagaggcttttcagcaagccttggctgctgcaggagat aaacttgtagtagttgatttctcagccacatggtgtgggccttgcaaaatgatcaaacct ttctttcattccctgtctgaaaaatattccaacgtgttgttccttgaagtagatgtggat gactgtcaggacattgctgcagagtgtgaagtcaaatgcatgccaaccttccagtttttt aaaaagggtgaaaaggtgggtgagttttctggcgctaataaggaaaagcttgaagccacc attactgaattagtctaa

DBGET integrated database retrieval system