Heterocephalus glaber (naked mole-rat): 101718152 Help Entry 101718152         CDS       T02812                                  Symbol Il13 Name (RefSeq) interleukin 13   KO K05435   interleukin 13 Organism hgl  Heterocephalus glaber (naked mole-rat) Pathway hgl04060   Cytokine-cytokine receptor interaction hgl04630   JAK-STAT signaling pathway hgl04657   IL-17 signaling pathway hgl04658   Th1 and Th2 cell differentiation hgl04664   Fc epsilon RI signaling pathway hgl05200   Pathways in cancer hgl05310   Asthma hgl05321   Inflammatory bowel disease Brite KEGG Orthology (KO) [BR:hgl00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     101718152 (Il13)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     101718152 (Il13)  09150 Organismal Systems   09151 Immune system    04658 Th1 and Th2 cell differentiation     101718152 (Il13)    04657 IL-17 signaling pathway     101718152 (Il13)    04664 Fc epsilon RI signaling pathway     101718152 (Il13)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     101718152 (Il13)   09163 Immune disease    05310 Asthma     101718152 (Il13)    05321 Inflammatory bowel disease     101718152 (Il13)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:hgl04052]     101718152 (Il13) Cytokines and neuropeptides [BR:hgl04052]  Cytokines   Interleukins    101718152 (Il13) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL13 Motif Other DBs NCBI-GeneID:  101718152 NCBI-ProteinID:  XP_004836668 UniProt:  A0AAX6NTL6 LinkDB All DBs Position Un AA seq 131 aa AA seqDB search MALWVTVVLALTCLSALTAPGPVPSSAALRELIEELANVTQNHKTPLCSGSMVWSVNLTA GWYCAARESLINVSSCSALQRTQKILSSLCQHRAVAKVSSFHNRDTKIEVAQFVQTLLRY LQSLYRHGNFN NT seq 396 nt NT seq  +upstreamnt  +downstreamnt atggcgctctgggtgactgtggtcctcgctctcacctgcctcagtgccctcacagccccg ggccccgtgccttcctccgcagccctcagggagctcatcgaggagctggccaacgtcacg cagaaccacaagactcccctctgcagcggcagcatggtgtggagtgtcaacctgacagct ggctggtactgtgctgcccgcgagtccctgatcaacgtctccagctgcagcgccctgcag aggacccagaagatcctgagcagtctctgccagcacagggccgtggccaaggtttccagc ttccacaaccgagacaccaaaattgaagtggcccaattcgtgcagacactgctccgatat ttacagagcctttatcgccacggaaacttcaactga

DBGET integrated database retrieval system