Heterocephalus glaber (naked mole-rat): 101720581 Help Entry 101720581         CDS       T02812                                  Symbol Il2 Name (RefSeq) interleukin 2   KO K05429   interleukin 2 Organism hgl  Heterocephalus glaber (naked mole-rat) Pathway hgl04060   Cytokine-cytokine receptor interaction hgl04061   Viral protein interaction with cytokine and cytokine receptor hgl04151   PI3K-Akt signaling pathway hgl04625   C-type lectin receptor signaling pathway hgl04630   JAK-STAT signaling pathway hgl04658   Th1 and Th2 cell differentiation hgl04659   Th17 cell differentiation hgl04660   T cell receptor signaling pathway hgl04672   Intestinal immune network for IgA production hgl04940   Type I diabetes mellitus hgl05135   Yersinia infection hgl05142   Chagas disease hgl05162   Measles hgl05166   Human T-cell leukemia virus 1 infection hgl05171   Coronavirus disease - COVID-19 hgl05200   Pathways in cancer hgl05320   Autoimmune thyroid disease hgl05321   Inflammatory bowel disease hgl05330   Allograft rejection hgl05332   Graft-versus-host disease Brite KEGG Orthology (KO) [BR:hgl00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     101720581 (Il2)    04151 PI3K-Akt signaling pathway     101720581 (Il2)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     101720581 (Il2)    04061 Viral protein interaction with cytokine and cytokine receptor     101720581 (Il2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     101720581 (Il2)    04660 T cell receptor signaling pathway     101720581 (Il2)    04658 Th1 and Th2 cell differentiation     101720581 (Il2)    04659 Th17 cell differentiation     101720581 (Il2)    04672 Intestinal immune network for IgA production     101720581 (Il2)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     101720581 (Il2)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     101720581 (Il2)    05171 Coronavirus disease - COVID-19     101720581 (Il2)    05162 Measles     101720581 (Il2)   09171 Infectious disease: bacterial    05135 Yersinia infection     101720581 (Il2)   09174 Infectious disease: parasitic    05142 Chagas disease     101720581 (Il2)   09163 Immune disease    05320 Autoimmune thyroid disease     101720581 (Il2)    05321 Inflammatory bowel disease     101720581 (Il2)    05330 Allograft rejection     101720581 (Il2)    05332 Graft-versus-host disease     101720581 (Il2)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     101720581 (Il2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:hgl04052]     101720581 (Il2)    00536 Glycosaminoglycan binding proteins [BR:hgl00536]     101720581 (Il2) Cytokines and neuropeptides [BR:hgl04052]  Cytokines   Interleukins    101720581 (Il2) Glycosaminoglycan binding proteins [BR:hgl00536]  Heparan sulfate / Heparin   Cytokines    101720581 (Il2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL2 DUF2509 DUF6815 Motif Other DBs NCBI-GeneID:  101720581 NCBI-ProteinID:  XP_004854993 UniProt:  A0AAX6PM50 LinkDB All DBs Position Un AA seq 152 aa AA seqDB search MYKMLLLSCIALTLALITSSAPTSSSTRETQEQLEQLLLDLQVILKGVTRNPKLSKMLKP KLYFPNKPSELQHLQCLEEELKVLEQVLNLAEHKHFPLINTKDFISNINVTVWKLKGSKT ALTCELNDEEANIVQFLKGWIAFCQKIISTMT NT seq 459 nt NT seq  +upstreamnt  +downstreamnt atgtacaagatgctgctcttgtcttgcattgcactaactcttgcactcatcacaagcagt gcaccaacttcaagctctacaagggaaacacaggaacaactggagcaattgctgctggat ttacaggtgattttgaaaggagttactaggaatcccaaactctccaagatgctaaaacct aaactctactttcccaataaaccctcagaattgcaacatcttcagtgcctagaagaagaa ctcaaagtcctggagcaagtgctaaatctagctgaacacaaacactttcccttgataaat accaaggatttcatcagtaatatcaacgtaacagtttggaaactaaagggatccaaaaca gcactcacgtgtgaactgaatgatgaagaagcaaacattgtacaatttctgaaaggatgg attgccttttgtcagaaaatcatctcaacaatgacttaa

DBGET integrated database retrieval system