Heterocephalus glaber (naked mole-rat): 101721979 Help Entry 101721979         CDS       T02812                                  Symbol Dynlt1 Name (RefSeq) dynein light chain Tctex-type 1   KO K10420   dynein light chain Tctex-type 1/3 Organism hgl  Heterocephalus glaber (naked mole-rat) Pathway hgl04814   Motor proteins hgl05132   Salmonella infection Brite KEGG Orthology (KO) [BR:hgl00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     101721979 (Dynlt1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     101721979 (Dynlt1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:hgl03037]     101721979 (Dynlt1)    04812 Cytoskeleton proteins [BR:hgl04812]     101721979 (Dynlt1) Cilium and associated proteins [BR:hgl03037]  Motile cilia and associated proteins   Dynein arm    101721979 (Dynlt1) Cytoskeleton proteins [BR:hgl04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      101721979 (Dynlt1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Tctex-1 P22_AR_C Motif Other DBs NCBI-GeneID:  101721979 NCBI-ProteinID:  XP_004874608 UniProt:  G5BCM4 LinkDB All DBs Position Un AA seq 113 aa AA seqDB search MEDYQSSEETAFVVDEVSNIVKEAIESAIGGNAYQHSKVNQWTTNVVEQTLSQLTKLGKP FKYIVTCVIMQKNGAGLHTASSCFWDSNTDGSCTVRWENKTMYCIVSTFGLSI NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atggaagactaccagagttccgaggagactgcttttgttgttgatgaagtaagcaacatt gtaaaagaggccatcgaaagtgccatcggcggtaacgcttaccagcacagcaaagtcaat cagtggaccaccaatgtagtagagcaaactctaagccaactcaccaagctgggaaaacca tttaaatacatcgtgacctgtgtaattatgcaaaagaatggagctggattacacacagcg agttcctgcttctgggacagcaatactgatgggagctgcactgtgcgatgggagaacaag accatgtactgcatcgtcagcaccttcggactgtccatttga

DBGET integrated database retrieval system