Heterocephalus glaber (naked mole-rat): 101722111 Help Entry 101722111         CDS       T02812                                  Name (RefSeq) protein S100-A10   KO K17274   protein S100-A10 Organism hgl  Heterocephalus glaber (naked mole-rat) Pathway hgl04382   Cornified envelope formation hgl05132   Salmonella infection Brite KEGG Orthology (KO) [BR:hgl00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     101722111  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     101722111  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hgl04147]     101722111 Exosome [BR:hgl04147]  Exosomal proteins   Exosomal proteins of microglial cells    101722111 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 EFhand_Ca_insen TMP_3 Motif Other DBs NCBI-GeneID:  101722111 NCBI-ProteinID:  XP_004855308 UniProt:  G5AQ18 LinkDB All DBs Position Un AA seq 97 aa AA seqDB search MPYQMEHAMETMMFTFHKFAGDKGYLKKEDLRVLMEGEFPGFLENQKDPLAVDKIMKDLD QCRDGKMGFQSFFSLIAGLTTACNDYFVVHMKQKGKK NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgccataccaaatggaacatgctatggaaaccatgatgtttacgtttcacaaatttgct ggagacaaaggctacttaaagaaggaggacctgcgagtactcatggaaggggagttccct gggtttttggaaaatcaaaaagatcctctggctgtggacaaaatcatgaaggacctggac cagtgccgagatggcaaaatgggcttccagagcttcttttcactaattgcaggcctcacc actgcatgcaatgattattttgtagtgcacatgaagcagaagggaaagaagtag

DBGET integrated database retrieval system